Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Chasing Graves

anchored on:secondary worldfantasygrimdark

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories in which extraterrestrial beings are central — as characters, cultures, or the object of the plot.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories about mental unraveling — descent into madness, delusion, and minds at war with themselves.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of A Song of Ice and Fire
                  A Song of Ice and Fire

                  series · 14 books · 1996

                  part of World of Ice and Fire

                  similar bysecondary worlddarkfantasyepic fantasy+2 more

                  A Song of Ice and Fire is a series of high fantasy novels by the American author George R. R. Martin. Martin began writing the first volume, A Game of Thrones, in 1991, and published it in 1996. Martin, who originally envisioned the series as a trilogy, has released five out of seven planned volumes. The most recent entry in the series, A Dance with Dragons, was published in 2011. Since then, Martin has been working on the sixth novel, titled The Winds of Winter. A seventh novel, A Dream of Spring, is planned to follow.

                • Cover of Malazan Book of the Fallen
                  Malazan Book of the Fallen

                  series · 20 books · 1999

                  part of Malazan

                  similar bysecondary worlddarkfantasygrimdarkepic fantasy+1 more

                  The Malazan Book of the Fallen is a series of epic fantasy novels written by the Canadian author Steven Erikson. The series, published by Bantam Books in the U.K. and Tor Books in the U.S., consists of ten volumes, beginning with Gardens of the Moon (1999) and concluding with The Crippled God (2011). Erikson's series presents the narratives of a large cast of characters spanning thousands of years across multiple continents.

                • Cover of The Circle of the World
                  The Circle of the World

                  universe · 29 books · 2006

                  Start hereThe Blade Itself · Start here

                  similar bysecondary worldgrimdarkfantasy+2 more

                  You want heroes? Best look elsewhere. The Circle of the World has kings and wizards and famous barbarians enough, but scratch any of them and you'll find a coward, a schemer, or a killer who's simply better at it than the rest. This is Joe Abercrombie's fantasy world: a grimy, blood-soaked continent where the fat and corrupt Union squats between the savage North and the scheming South, and where every noble cause turns out to have a knife hidden behind it. It opens with the First Law trilogy — The Blade Itself, Before They Are Hanged, Last Argument of Kings — following a crippled torturer with a razor wit, a weary Northman who would dearly like to stop fighting and can't, and a bald old wizard whose plans run older and colder than anyone guesses. Three self-contained standalones share the same ground and a familiar face or two: Best Served Cold takes its revenge across sunlit, murderous Styria; The Heroes crushes a whole war into three days over one worthless hill; Red Country rides the frontier. Short pieces (Sharp Ends) fill the gaps, and a generation on, the Age of Madness trilogy drags the old survivors into an age of factories, mobs, and revolution. What sets it apart is the honesty of its cynicism — close, sardonic points of view, gallows humour, and a flat refusal to let anyone stay clean. Violence carries a cost here; victory rarely settles anything; the wheel just turns and grinds someone new under it. Abercrombie recommends reading in publication order, and it's the right call: begin with The Blade Itself and let the world curdle around you. You have to be realistic about these things.

                • Cover of Malazan
                  Malazan

                  universe · 36 books · 1999

                  Start hereMalazan Book of the Fallen · Start here

                  similar bysecondary worlddarkepic fantasy+3 more

                  Pity the historian who tries to map this world; pity more the god who thinks he rules it. The Malazan Empire marches across continents on the boots of its common soldiers, and above them move Ascendants — mortals grown into something like gods, and gods worn thin as old coin. Magic is drawn from Warrens, roads of power threaded through reality; the dead keep their grudges; and every empire, however vast, is a wager against time. This is epic fantasy told from the mud, where a sapper cracking a joke weighs as much as an immortal settling a feud older than the human race. The world began as a tabletop campaign two friends built in the 1980s, and it still moves by two hands. Steven Erikson's ten-volume Malazan Book of the Fallen is the spine — Gardens of the Moon, Deadhouse Gates, Memories of Ice, on through The Crippled God — each book a near-standalone campaign that only later reveals how it locks together. Ian C. Esslemont walks the same years from a different vantage in his Novels of the Malazan Empire (Night of Knives, Return of the Crimson Guard onward). Around them stand the prequels: Erikson's Kharkanas Trilogy, archaic and elegiac, chronicling a doomed elder people, and Esslemont's brisker Path to Ascendancy, following two adventurers before they became legends. Erikson's Witness sequence carries the tale forward, and novellas of the genial necromancers Bauchelain and Korbal Broach supply the gallows comedy. Nothing is explained to you; comprehension is earned, and that is the pleasure. The themes run deep — compassion set against cruelty, the toll empires charge, civilizations that fall and are mourned. Begin where the saga does, with Erikson's Gardens of the Moon, and read the ten in publication order; the prequels are for the already-initiated. Trust that confusion is the price of entry.

                • Cover of The Poppy War
                  The Poppy War

                  series · 4 books · 2018

                  similar bysecondary worlddarktensegrimdarkfantasyepic fantasy+1 more

                  The Poppy War follows Rin, a war orphan who tests into an elite military academy and discovers a talent for shamanic power tied to a pantheon of vengeful gods. R. F. Kuang's trilogy reworks the Second Sino-Japanese War and its atrocities into an epic fantasy that grows darker and more morally compromised as it goes. It's told across The Poppy War, The Dragon Republic, and The Burning God.

                • Cover of Parallel Universe
                  Parallel Universe

                  series · 5 books · 1991

                  similar bysecondary worlddarktensefantasy

                • TO
                  The Old Kingdom / Abhorsen milieu

                  series · 11 books · 1995

                  similar bysecondary worldfantasy+3 more

                  The Old Kingdom, or Abhorsen in North America and the UK, is a fantasy series written by Australian author Garth Nix. It originated in 1995 with the novel Sabriel and has continued in the novels Lirael (2001), Abhorsen (2003), Goldenhand (2016), and Terciel & Elinor (2021), as well as a prequel novel titled Clariel (2014). The Old Kingdom also consists of the novella The Creature in the Case (2005) and various other short fiction.

                • Cover of Earthsea Cycle
                  Earthsea Cycle

                  series · 18 books · 1964

                  completed

                  part of Earthsea

                  similar bysecondary worldfantasyepic fantasy

                  The Earthsea Cycle, also known as Earthsea, is a series of high fantasy books written by American author Ursula K. Le Guin. Beginning with A Wizard of Earthsea (1968), The Tombs of Atuan (1970), and The Farthest Shore (1972), the series was continued in Tehanu (1990), and Tales from Earthsea and The Other Wind. In 2018, all the novels and short stories were published in a single volume, The Books of Earthsea: The Complete Illustrated Edition, with artwork by Charles Vess.

                • Cover of Shattered Sea
                  Shattered Sea

                  series · 4 books · 2014

                  similar bysecondary worlddarkfantasyepic fantasy+3 more

                  Shattered Sea is a young adult fantasy series written by the British author Joe Abercrombie. The trilogy was published by Del Rey in the United States and Harper Voyager in the UK.

                • Cover of The Castings World
                  The Castings World

                  series · 4 books · 2007

                  similar bysecondary worldfantasyepic fantasy+2 more

                • Cover of Rigante
                  Rigante

                  series · 4 books · 1998

                  completed

                  similar bysecondary worlddarkfantasyepic fantasy+3 more

                  Sword in the Storm opens David Gemmell's Rigante sequence, following Connavar, a young tribesman of the Rigante people whose homeland faces both internal clan conflict and the looming threat of a technologically superior empire modeled on Rome. The series spans generations of the Rigante across four novels, mixing Gemmell's trademark heroic-fantasy action with Celtic-flavored history. It was published between 1998 and 2002.

                • Cover of Six of Crows
                  Six of Crows

                  series · 3 books · 2015

                  part of Grishaverse

                  similar bysecondary worldrevengedarktensefantasy

                  Leigh Bardugo's Six of Crows duology (2015-2016) follows a crew of six criminal teenagers in Ketterdam, a city modeled on the Dutch Republic, as they pull off a near-impossible heist and then deal with its fallout. Told from multiple points of view, the books lean on the found-family bond between the crew members as much as the caper plotting, and sit within Bardugo's wider Grishaverse alongside her Shadow and Bone books.

                • Cover of Gentleman Bastard Sequence
                  Gentleman Bastard Sequence

                  series · 7 books · 2006

                  similar bysecondary worldfantasy

                  Scott Lynch's Gentleman Bastard sequence follows Locke Lamora, an orphan-raised master thief and con artist, and his gang of 'Gentleman Bastards' as they run elaborate grifts on the nobility of Camorr, a canal city modeled on Renaissance Venice. The Lies of Locke Lamora and its two sequels braid heist capers with flashbacks tracing how the gang was trained, escalating into a wider conflict involving crime lords and sorcerers. Lynch has planned seven books in total; three have been published so far, with long gaps between installments.

                • Cover of Shadow Rogue
                  Shadow Rogue

                  series · 4 books · 2019

                  similar bysecondary worldfantasy+4 more

                • Cover of An Ember in the Ashes
                  An Ember in the Ashes

                  series · 4 books · 2015

                  similar bysecondary worldtensefantasyepic fantasy+1 more

                  An Ember in the Ashes, set in a fantasy world modeled on ancient Rome, alternates between Laia, who spies on a brutal military academy for rebels in exchange for help freeing her imprisoned brother, and Elias, one of that academy's most skilled soldiers trying to break free of the empire he's been raised to serve. Sabaa Tahir's quartet, continuing through A Torch Against the Night, A Reaper at the Gates, and A Sky Beyond the Storm, follows the two toward a reckoning with the empire that trained one of them to enforce it.

                • Cover of Nazhuret of Sordaling / Lens of the World
                  Nazhuret of Sordaling / Lens of the World

                  series · 3 books · 1990

                  similar bysecondary worldfantasy+3 more

                  Lens of the World is narrated by Nazhuret, an orphan and outcast who rises from the bottom of the Sordaling military school to become a formidable warrior, philosopher, and eventually confidant to the king of Bestinglon, telling his own unlikely rise in his own words. R. A. MacAvoy's trilogy continues through King of the Dead and Winter of the Wolf, following Nazhuret further into the politics of a court he was never meant to be part of.

                • DU
                  Deepgate Universe

                  series · 5 books · 2006

                  similar bysecondary worlddark+3 more

                • Cover of The Prison Healer
                  The Prison Healer

                  series · 3 books · 2021

                  similar bysecondary worldrevengetensefantasyepic fantasy+1 more

                  Lynette Noni's YA trilogy follows Kiva Meridan, a teenage healer imprisoned in the brutal death camp of Zalindov, who is forced to stand trial by combat in another prisoner's place when a mysterious rebel movement upends the prison's order. The Prison Healer, The Gilded Cage, and The Blood Traitor follow Kiva out of the prison and into a wider conflict over the kingdom's throne, testing where her loyalties actually lie. It sits in the current wave of grim, trial-driven YA fantasy.

                • Cover of Thomas Cale
                  Thomas Cale

                  series · 4 books · 2010

                  similar bysecondary worlddark+4 more

                  Paul Hoffman's Thomas Cale series opens with The Left Hand of God, following a boy raised by a brutal religious military order who escapes into a wider world he's been kept ignorant of. The subsequent books, The Last Four Things, The Beating of His Wings, and The White Devil, follow Cale as the skills that order trained into him make him useful, and dangerous, to larger powers. It's a bleak, war-driven coming-of-age arc rather than a conventional chosen-one fantasy.

                • Cover of Wars of Vis
                  Wars of Vis

                  series · 3 books · 1976

                  completed

                  similar bysecondary worlddarkfantasyepic fantasy+2 more

                  Tanith Lee's Wars of Vis trilogy is set on a world of feuding city-states, following the warlord Raldnor Am Anackire's rise as long-buried tensions between the pale-skinned Vis and darker-skinned Lowlanders erupt into open war and the revelation of hidden power. The Storm Lord opens the trilogy, continued by Anackire and The White Serpent.

                • Cover of The Riftwar Universe
                  The Riftwar Universe

                  universe · 44 books · 1982

                  Start hereRiftwar Saga · Start here

                  similar bysecondary worldfantasyepic fantasy+1 more

                  On the world of Midkemia a tear opens in the air itself, a rift hung between stars, and through it march the armies of an empire from another world entirely. So begins the chronicle Raymond E. Feist has kept for three decades: the tale of Pug, a castle kitchen boy apprenticed to a magician on the very day the invasion lands, and of Tomas, his friend, who inherits the armor and the ancient fury of a dead dragon-lord. Around these two the Riftwar Cycle turns, widening book by book from one besieged frontier keep into the whole history of a world of kingdoms, guilds, thieves' dens and mage-towers. The cycle runs to roughly thirty novels, gathered into arcs a newcomer can enter and finish on their own. The founding Riftwar Saga (Magician, Silverthorn, A Darkness at Sethanon) sets the board; the Serpentwar Saga, Krondor's Sons and the Conclave of Shadows carry the story down the generations; the Darkwar, Demonwar and Chaoswar sagas bring it toward its close. Crossing the rift to the rival world of Kelewan, Feist and Janny Wurts wrote the Empire trilogy, opening with Daughter of the Empire, a court intrigue told wholly from the invaders' side and for many the finest thing here. Shorter Legends of the Riftwar and the game-born Riftwar Legacy fill the corners; later still, Feist opens an altogether new world in the Firemane books. Feist writes fantasy in its most companionable key: apprentices who grow into archmages, tavern boys who become spies and dukes, a world you return to the way you return to an old inn. The mood is adventure before dread, friendship and rank and hard-won craft, wars that cost something, all of it rendered plainly and at a gallop. Begin where it began, with Magician, then follow the arcs in the order they were written, and the rift will carry you the rest of the way.

                • Cover of Land Fit for Heroes
                  Land Fit for Heroes

                  series · 3 books · 2008

                  similar bysecondary worldgrimdark+4 more

                • Cover of The Bone Witch
                  The Bone Witch

                  series · 3 books · 2017

                  similar bysecondary worldundeaddarkfantasy+3 more

                • KL
                  Kushiel's Legacy Universe

                  series · 13 books · 2001

                  similar bysecondary worldfantasy+2 more