More like Chasing Graves
anchored on:secondary worldfantasygrimdark
but
- A Song of Ice and Fire
series14 books1996
part of World of Ice and Fire
similar bysecondary worlddarkfantasyepic fantasy+2 more
A Song of Ice and Fire is a series of high fantasy novels by the American author George R. R. Martin. Martin began writing the first volume, A Game of Thrones, in 1991, and published it in 1996. Martin, who originally envisioned the series as a trilogy, has released five out of seven planned volumes. The most recent entry in the series, A Dance with Dragons, was published in 2011. Since then, Martin has been working on the sixth novel, titled The Winds of Winter. A seventh novel, A Dream of Spring, is planned to follow.
- Malazan Book of the Fallen
series20 books1999
part of Malazan
similar bysecondary worlddarkfantasygrimdarkepic fantasy+1 more
The Malazan Book of the Fallen is a series of epic fantasy novels written by the Canadian author Steven Erikson. The series, published by Bantam Books in the U.K. and Tor Books in the U.S., consists of ten volumes, beginning with Gardens of the Moon (1999) and concluding with The Crippled God (2011). Erikson's series presents the narratives of a large cast of characters spanning thousands of years across multiple continents.
- The Circle of the World
universe29 books2006
Start hereThe Blade Itself · Start here
similar bysecondary worldgrimdarkfantasy+2 more
You want heroes? Best look elsewhere. The Circle of the World has kings and wizards and famous barbarians enough, but scratch any of them and you'll find a coward, a schemer, or a killer who's simply better at it than the rest. This is Joe Abercrombie's fantasy world: a grimy, blood-soaked continent where the fat and corrupt Union squats between the savage North and the scheming South, and where every noble cause turns out to have a knife hidden behind it. It opens with the First Law trilogy — The Blade Itself, Before They Are Hanged, Last Argument of Kings — following a crippled torturer with a razor wit, a weary Northman who would dearly like to stop fighting and can't, and a bald old wizard whose plans run older and colder than anyone guesses. Three self-contained standalones share the same ground and a familiar face or two: Best Served Cold takes its revenge across sunlit, murderous Styria; The Heroes crushes a whole war into three days over one worthless hill; Red Country rides the frontier. Short pieces (Sharp Ends) fill the gaps, and a generation on, the Age of Madness trilogy drags the old survivors into an age of factories, mobs, and revolution. What sets it apart is the honesty of its cynicism — close, sardonic points of view, gallows humour, and a flat refusal to let anyone stay clean. Violence carries a cost here; victory rarely settles anything; the wheel just turns and grinds someone new under it. Abercrombie recommends reading in publication order, and it's the right call: begin with The Blade Itself and let the world curdle around you. You have to be realistic about these things.
- Malazan
universe36 books1999
Start hereMalazan Book of the Fallen · Start here
similar bysecondary worlddarkepic fantasy+3 more
Pity the historian who tries to map this world; pity more the god who thinks he rules it. The Malazan Empire marches across continents on the boots of its common soldiers, and above them move Ascendants — mortals grown into something like gods, and gods worn thin as old coin. Magic is drawn from Warrens, roads of power threaded through reality; the dead keep their grudges; and every empire, however vast, is a wager against time. This is epic fantasy told from the mud, where a sapper cracking a joke weighs as much as an immortal settling a feud older than the human race. The world began as a tabletop campaign two friends built in the 1980s, and it still moves by two hands. Steven Erikson's ten-volume Malazan Book of the Fallen is the spine — Gardens of the Moon, Deadhouse Gates, Memories of Ice, on through The Crippled God — each book a near-standalone campaign that only later reveals how it locks together. Ian C. Esslemont walks the same years from a different vantage in his Novels of the Malazan Empire (Night of Knives, Return of the Crimson Guard onward). Around them stand the prequels: Erikson's Kharkanas Trilogy, archaic and elegiac, chronicling a doomed elder people, and Esslemont's brisker Path to Ascendancy, following two adventurers before they became legends. Erikson's Witness sequence carries the tale forward, and novellas of the genial necromancers Bauchelain and Korbal Broach supply the gallows comedy. Nothing is explained to you; comprehension is earned, and that is the pleasure. The themes run deep — compassion set against cruelty, the toll empires charge, civilizations that fall and are mourned. Begin where the saga does, with Erikson's Gardens of the Moon, and read the ten in publication order; the prequels are for the already-initiated. Trust that confusion is the price of entry.
- The Poppy War
series4 books2018
similar bysecondary worlddarktensegrimdarkfantasyepic fantasy+1 more
The Poppy War follows Rin, a war orphan who tests into an elite military academy and discovers a talent for shamanic power tied to a pantheon of vengeful gods. R. F. Kuang's trilogy reworks the Second Sino-Japanese War and its atrocities into an epic fantasy that grows darker and more morally compromised as it goes. It's told across The Poppy War, The Dragon Republic, and The Burning God.
- The Old Kingdom / Abhorsen milieu
series11 books1995
similar bysecondary worldfantasy+3 more
The Old Kingdom, or Abhorsen in North America and the UK, is a fantasy series written by Australian author Garth Nix. It originated in 1995 with the novel Sabriel and has continued in the novels Lirael (2001), Abhorsen (2003), Goldenhand (2016), and Terciel & Elinor (2021), as well as a prequel novel titled Clariel (2014). The Old Kingdom also consists of the novella The Creature in the Case (2005) and various other short fiction.
- Earthsea Cycle
series18 books1964
completed
part of Earthsea
similar bysecondary worldfantasyepic fantasy
The Earthsea Cycle, also known as Earthsea, is a series of high fantasy books written by American author Ursula K. Le Guin. Beginning with A Wizard of Earthsea (1968), The Tombs of Atuan (1970), and The Farthest Shore (1972), the series was continued in Tehanu (1990), and Tales from Earthsea and The Other Wind. In 2018, all the novels and short stories were published in a single volume, The Books of Earthsea: The Complete Illustrated Edition, with artwork by Charles Vess.
- Shattered Sea
series4 books2014
similar bysecondary worlddarkfantasyepic fantasy+3 more
Shattered Sea is a young adult fantasy series written by the British author Joe Abercrombie. The trilogy was published by Del Rey in the United States and Harper Voyager in the UK.
- Rigante
series4 books1998
completed
similar bysecondary worlddarkfantasyepic fantasy+3 more
Sword in the Storm opens David Gemmell's Rigante sequence, following Connavar, a young tribesman of the Rigante people whose homeland faces both internal clan conflict and the looming threat of a technologically superior empire modeled on Rome. The series spans generations of the Rigante across four novels, mixing Gemmell's trademark heroic-fantasy action with Celtic-flavored history. It was published between 1998 and 2002.
- Six of Crows
series3 books2015
part of Grishaverse
similar bysecondary worldrevengedarktensefantasy
Leigh Bardugo's Six of Crows duology (2015-2016) follows a crew of six criminal teenagers in Ketterdam, a city modeled on the Dutch Republic, as they pull off a near-impossible heist and then deal with its fallout. Told from multiple points of view, the books lean on the found-family bond between the crew members as much as the caper plotting, and sit within Bardugo's wider Grishaverse alongside her Shadow and Bone books.
- Gentleman Bastard Sequence
series7 books2006
similar bysecondary worldfantasy
Scott Lynch's Gentleman Bastard sequence follows Locke Lamora, an orphan-raised master thief and con artist, and his gang of 'Gentleman Bastards' as they run elaborate grifts on the nobility of Camorr, a canal city modeled on Renaissance Venice. The Lies of Locke Lamora and its two sequels braid heist capers with flashbacks tracing how the gang was trained, escalating into a wider conflict involving crime lords and sorcerers. Lynch has planned seven books in total; three have been published so far, with long gaps between installments.
- An Ember in the Ashes
series4 books2015
similar bysecondary worldtensefantasyepic fantasy+1 more
An Ember in the Ashes, set in a fantasy world modeled on ancient Rome, alternates between Laia, who spies on a brutal military academy for rebels in exchange for help freeing her imprisoned brother, and Elias, one of that academy's most skilled soldiers trying to break free of the empire he's been raised to serve. Sabaa Tahir's quartet, continuing through A Torch Against the Night, A Reaper at the Gates, and A Sky Beyond the Storm, follows the two toward a reckoning with the empire that trained one of them to enforce it.
- Nazhuret of Sordaling / Lens of the World
series3 books1990
similar bysecondary worldfantasy+3 more
Lens of the World is narrated by Nazhuret, an orphan and outcast who rises from the bottom of the Sordaling military school to become a formidable warrior, philosopher, and eventually confidant to the king of Bestinglon, telling his own unlikely rise in his own words. R. A. MacAvoy's trilogy continues through King of the Dead and Winter of the Wolf, following Nazhuret further into the politics of a court he was never meant to be part of.
- The Prison Healer
series3 books2021
similar bysecondary worldrevengetensefantasyepic fantasy+1 more
Lynette Noni's YA trilogy follows Kiva Meridan, a teenage healer imprisoned in the brutal death camp of Zalindov, who is forced to stand trial by combat in another prisoner's place when a mysterious rebel movement upends the prison's order. The Prison Healer, The Gilded Cage, and The Blood Traitor follow Kiva out of the prison and into a wider conflict over the kingdom's throne, testing where her loyalties actually lie. It sits in the current wave of grim, trial-driven YA fantasy.
- Thomas Cale
series4 books2010
similar bysecondary worlddark+4 more
Paul Hoffman's Thomas Cale series opens with The Left Hand of God, following a boy raised by a brutal religious military order who escapes into a wider world he's been kept ignorant of. The subsequent books, The Last Four Things, The Beating of His Wings, and The White Devil, follow Cale as the skills that order trained into him make him useful, and dangerous, to larger powers. It's a bleak, war-driven coming-of-age arc rather than a conventional chosen-one fantasy.
- Wars of Vis
series3 books1976
completed
similar bysecondary worlddarkfantasyepic fantasy+2 more
Tanith Lee's Wars of Vis trilogy is set on a world of feuding city-states, following the warlord Raldnor Am Anackire's rise as long-buried tensions between the pale-skinned Vis and darker-skinned Lowlanders erupt into open war and the revelation of hidden power. The Storm Lord opens the trilogy, continued by Anackire and The White Serpent.
- The Riftwar Universe
universe44 books1982
Start hereRiftwar Saga · Start here
similar bysecondary worldfantasyepic fantasy+1 more
On the world of Midkemia a tear opens in the air itself, a rift hung between stars, and through it march the armies of an empire from another world entirely. So begins the chronicle Raymond E. Feist has kept for three decades: the tale of Pug, a castle kitchen boy apprenticed to a magician on the very day the invasion lands, and of Tomas, his friend, who inherits the armor and the ancient fury of a dead dragon-lord. Around these two the Riftwar Cycle turns, widening book by book from one besieged frontier keep into the whole history of a world of kingdoms, guilds, thieves' dens and mage-towers. The cycle runs to roughly thirty novels, gathered into arcs a newcomer can enter and finish on their own. The founding Riftwar Saga (Magician, Silverthorn, A Darkness at Sethanon) sets the board; the Serpentwar Saga, Krondor's Sons and the Conclave of Shadows carry the story down the generations; the Darkwar, Demonwar and Chaoswar sagas bring it toward its close. Crossing the rift to the rival world of Kelewan, Feist and Janny Wurts wrote the Empire trilogy, opening with Daughter of the Empire, a court intrigue told wholly from the invaders' side and for many the finest thing here. Shorter Legends of the Riftwar and the game-born Riftwar Legacy fill the corners; later still, Feist opens an altogether new world in the Firemane books. Feist writes fantasy in its most companionable key: apprentices who grow into archmages, tavern boys who become spies and dukes, a world you return to the way you return to an old inn. The mood is adventure before dread, friendship and rank and hard-won craft, wars that cost something, all of it rendered plainly and at a gallop. Begin where it began, with Magician, then follow the arcs in the order they were written, and the rift will carry you the rest of the way.
