Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Dark Convergence

anchored on:fantasysecondary world

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories in which extraterrestrial beings are central — as characters, cultures, or the object of the plot.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories about mental unraveling — descent into madness, delusion, and minds at war with themselves.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of A Song of Ice and Fire
                  A Song of Ice and Fire

                  series · 14 books · 1996

                  part of World of Ice and Fire

                  similar bypolitical intriguesecondary worldfantasydarkwar+2 more

                  A Song of Ice and Fire is a series of high fantasy novels by the American author George R. R. Martin. Martin began writing the first volume, A Game of Thrones, in 1991, and published it in 1996. Martin, who originally envisioned the series as a trilogy, has released five out of seven planned volumes. The most recent entry in the series, A Dance with Dragons, was published in 2011. Since then, Martin has been working on the sixth novel, titled The Winds of Winter. A seventh novel, A Dream of Spring, is planned to follow.

                • Cover of Malazan Book of the Fallen
                  Malazan Book of the Fallen

                  series · 20 books · 1999

                  part of Malazan

                  similar bysecondary worldfantasydarkwargrimdark+2 more

                  The Malazan Book of the Fallen is a series of epic fantasy novels written by the Canadian author Steven Erikson. The series, published by Bantam Books in the U.K. and Tor Books in the U.S., consists of ten volumes, beginning with Gardens of the Moon (1999) and concluding with The Crippled God (2011). Erikson's series presents the narratives of a large cast of characters spanning thousands of years across multiple continents.

                • Cover of Malazan
                  Malazan

                  universe · 36 books · 1999

                  Start hereMalazan Book of the Fallen · Start here

                  similar bysecondary worlddarkwar+4 more

                  Pity the historian who tries to map this world; pity more the god who thinks he rules it. The Malazan Empire marches across continents on the boots of its common soldiers, and above them move Ascendants — mortals grown into something like gods, and gods worn thin as old coin. Magic is drawn from Warrens, roads of power threaded through reality; the dead keep their grudges; and every empire, however vast, is a wager against time. This is epic fantasy told from the mud, where a sapper cracking a joke weighs as much as an immortal settling a feud older than the human race. The world began as a tabletop campaign two friends built in the 1980s, and it still moves by two hands. Steven Erikson's ten-volume Malazan Book of the Fallen is the spine — Gardens of the Moon, Deadhouse Gates, Memories of Ice, on through The Crippled God — each book a near-standalone campaign that only later reveals how it locks together. Ian C. Esslemont walks the same years from a different vantage in his Novels of the Malazan Empire (Night of Knives, Return of the Crimson Guard onward). Around them stand the prequels: Erikson's Kharkanas Trilogy, archaic and elegiac, chronicling a doomed elder people, and Esslemont's brisker Path to Ascendancy, following two adventurers before they became legends. Erikson's Witness sequence carries the tale forward, and novellas of the genial necromancers Bauchelain and Korbal Broach supply the gallows comedy. Nothing is explained to you; comprehension is earned, and that is the pleasure. The themes run deep — compassion set against cruelty, the toll empires charge, civilizations that fall and are mourned. Begin where the saga does, with Erikson's Gardens of the Moon, and read the ten in publication order; the prequels are for the already-initiated. Trust that confusion is the price of entry.

                • Cover of The Riftwar Universe
                  The Riftwar Universe

                  universe · 44 books · 1982

                  Start hereRiftwar Saga · Start here

                  similar bysecondary worldfantasy+3 more

                  On the world of Midkemia a tear opens in the air itself, a rift hung between stars, and through it march the armies of an empire from another world entirely. So begins the chronicle Raymond E. Feist has kept for three decades: the tale of Pug, a castle kitchen boy apprenticed to a magician on the very day the invasion lands, and of Tomas, his friend, who inherits the armor and the ancient fury of a dead dragon-lord. Around these two the Riftwar Cycle turns, widening book by book from one besieged frontier keep into the whole history of a world of kingdoms, guilds, thieves' dens and mage-towers. The cycle runs to roughly thirty novels, gathered into arcs a newcomer can enter and finish on their own. The founding Riftwar Saga (Magician, Silverthorn, A Darkness at Sethanon) sets the board; the Serpentwar Saga, Krondor's Sons and the Conclave of Shadows carry the story down the generations; the Darkwar, Demonwar and Chaoswar sagas bring it toward its close. Crossing the rift to the rival world of Kelewan, Feist and Janny Wurts wrote the Empire trilogy, opening with Daughter of the Empire, a court intrigue told wholly from the invaders' side and for many the finest thing here. Shorter Legends of the Riftwar and the game-born Riftwar Legacy fill the corners; later still, Feist opens an altogether new world in the Firemane books. Feist writes fantasy in its most companionable key: apprentices who grow into archmages, tavern boys who become spies and dukes, a world you return to the way you return to an old inn. The mood is adventure before dread, friendship and rank and hard-won craft, wars that cost something, all of it rendered plainly and at a gallop. Begin where it began, with Magician, then follow the arcs in the order they were written, and the rift will carry you the rest of the way.

                • DT
                  Dragon Trilogies

                  series · 6 books · 1988

                  similar bypolitical intriguesecondary worldfantasytense+1 more

                  The Dragon Prince and Dragon Star trilogies comprise six connected fantasy novels written by Melanie Rawn. The Dragon Prince trilogy focuses on Prince Rohan of the Desert and his Sunrunner wife, Sioned, while the Dragon Star trilogy focuses on their son, Pol. The Dragon Prince trilogy consists of novels Dragon Prince, The Star Scroll, and Sunrunner's Fire. The books in the Dragon Star trilogy are Stronghold, The Dragon Token, and Skybowl.

                • Cover of The Grisha
                  The Grisha

                  series · 9 books · 2012

                  part of Grishaverse

                  similar byfantasysecondary world+3 more

                  Leigh Bardugo is an American fantasy author. She is best known for her young adult Grishaverse novels, which include the Shadow and Bone trilogy and the Six of Crows and King of Scars duologies. She also received acclaim for her paranormal fantasy adult debut, Ninth House. The Shadow and Bone and Six of Crows series have been adapted into Shadow and Bone by Netflix, and Ninth House will be adapted by Amazon Studios; Bardugo is an executive producer on both works.

                • Cover of The Nikolai Duology
                  The Nikolai Duology

                  series · 2 books · 2019

                  part of Grishaverse

                  similar bypolitical intriguefantasysecondary worlddarktensewar

                  Leigh Bardugo's Nikolai Duology picks up Nikolai Lantsov and Zoya Nazyalensky from her earlier Grishaverse trilogy set in Ravka, now dealing with the kingdom's fallout as king and general, and adds Nina Zenik from the Six of Crows spin-off working a mission out of Ketterdam. King of Scars and its sequel Rule of Wolves tie together threads from across the wider Grishaverse rather than starting fresh, raising the stakes to a hidden threat inside Nikolai himself. It functions as the convergence point for Bardugo's separate Grishaverse story lines.

                • Cover of Dragon Age (Bioware RPG tie-in)
                  Dragon Age (Bioware RPG tie-in)

                  series · 21 books · 2009

                  similar bypolitical intriguefantasysecondary world+3 more

                  These tie-in novels expand BioWare's Dragon Age video game series into prose, mostly written by the games' own lead writers, and are set in the same dark-fantasy world of Thedas. The Stolen Throne and The Calling serve as prequels filling in the backstory of characters central to the first game, while later books such as Asunder and The Masked Empire tie more directly into the plots and politics of the sequels. They are written for players wanting deeper lore rather than as standalone entry points to the setting.

                • Cover of Shattered Sea
                  Shattered Sea

                  series · 4 books · 2014

                  similar bysecondary worldfantasydark+4 more

                  Shattered Sea is a young adult fantasy series written by the British author Joe Abercrombie. The trilogy was published by Del Rey in the United States and Harper Voyager in the UK.

                • SS
                  Skalan Saga

                  series · 17 books · 1996

                  similar bypolitical intriguefantasysecondary world

                • Cover of Targaryen History
                  Targaryen History

                  series · 4 books · 2013

                  part of World of Ice and Fire

                  similar bypolitical intriguefantasysecondary worlddarkwar+1 more

                  Set centuries before A Game of Thrones in George R. R. Martin's A Song of Ice and Fire universe, this history of House Targaryen traces the dynasty's founding, its wars, and its relationship with dragons through the voice of an in-world maester chronicler. Fire & Blood is the first of a planned two-part history, with the earlier novella The Princess and the Queen covering the dynastic civil war known as the Dance of the Dragons.

                • Cover of The Poppy War
                  The Poppy War

                  series · 4 books · 2018

                  similar bysecondary worldfantasydarktensewargrimdark+1 more

                  The Poppy War follows Rin, a war orphan who tests into an elite military academy and discovers a talent for shamanic power tied to a pantheon of vengeful gods. R. F. Kuang's trilogy reworks the Second Sino-Japanese War and its atrocities into an epic fantasy that grows darker and more morally compromised as it goes. It's told across The Poppy War, The Dragon Republic, and The Burning God.

                • Cover of The Powder Mage
                  The Powder Mage

                  universe · 19 books · 2013

                  Start hereThe Powder Mage Trilogy · Start here

                  similar bypolitical intriguesecondary worldfantasytensewar

                  Load your powder, and pray your sorcery outruns their cannon. Here the age of kings is ending at musket-point: a world where black powder is not merely fired but eaten, and the men and women called powder mages snort a pinch of it to burn a trance across the battlefield — igniting an enemy's cartridges from a mile off, bending a bullet mid-flight, reading a room by the taste of the air. Against them stand the Privileged, glove-fingered sorcerers of the old order who summon fire and frost, and above both, gods who have not finished walking the earth. Brian McClellan builds this flintlock world across two linked trilogies. The Powder Mage Trilogy — Promise of Blood, The Crimson Campaign, The Autumn Republic — opens with a field marshal's coup against a rotten monarchy and the invasion, revolution, and divine reckoning that follow. Gods of Blood and Powder — Sins of Empire, Wrath of Empire, Blood of Empire — crosses the ocean a decade on to the colonial frontier of Fatrasta, where old soldiers, spies, and a heretic goddess collide. A run of novellas and short stories fills the corners between. Expect grapeshot and gunsmoke, siege lines and back-alley intrigue, generals and con men given equal weight. Begin at Promise of Blood and read in publication order — the trilogies run in sequence, and the short work is seasoning, not prerequisite.

                • Cover of Cosmere
                  Cosmere

                  universe · 54 books · 2005

                  Start hereThe Final Empire · Start here

                  similar byfantasysecondary world+3 more

                  Before the worlds, there was Adonalsium, and then there was not. A god shattered into sixteen Shards of raw creative power, and those who seized them carried their fragments across the void to seed new planets, new peoples, new ways of working the impossible. The Cosmere is the one universe those Shards made: a scattering of worlds that seem, at first, to share nothing but a sky, until you notice the same law running quietly beneath each of them, and the same silent traveler passing through their margins. Every world keeps its own book and its own magic. On Scadrial, the Mistborn cycle burns metals into power: a self-contained trilogy of thieves and tyranny, followed by a second era that drags the same world into gunslinging early industry. On storm-battered Roshar, The Stormlight Archive raises its vast, ongoing epic around knights, spren, and oaths spoken aloud. Elsewhere stand the shorter keystones: Elantris, a city of fallen gods; Warbreaker, a tale of returned dead and living color; White Sand, told in graphic-novel form under the twin suns of Taldain. Threaded between them run the novellas, from Tress of the Emerald Sea and Yumi and the Nightmare Painter to The Sunlit Man and the pieces gathered in Arcanum Unbounded, where the hidden connections surface most plainly. All of it is the design of one hand, Brandon Sanderson, working a single pattern across two decades. What sets this universe apart is its faith in rules: magic here is a system, lawful and learnable, so discovery feels less like wonder handed down than like physics worked out. The cross-connections reward the patient reader, a symbol here, a name there, one immortal wanderer everywhere, but no book demands you have read another first. Newcomers do best entering through Mistborn: The Final Empire, the most self-contained doorway, or the standalone Elantris or Warbreaker; readers who prefer their epics vast can begin with The Way of Kings. The deeper links, and the novellas that expose them, wait for whenever you are ready to look.

                • Cover of The Lotus War
                  The Lotus War

                  series · 4 books · 2012

                  similar byfantasysecondary worlddark+4 more

                  The Lotus War is Jay Kristoff's steampunk fantasy trilogy set in a pollution-choked, Japanese-inspired empire: Stormdancer (2012), Kinslayer and Endsinger, with the novella The Last Stormdancer as a coda. It follows a young woman who tames a griffin-like beast thought extinct, drawing her into a rebellion against the empire's oppressive Shogunate. It is a complete trilogy plus novella.

                • Cover of King's Peace
                  King's Peace

                  series · 3 books · 2000

                  similar bypolitical intriguefantasysecondary worldwar

                  Jo Walton's The King's Peace opens an alternate-history retelling of the Arthur legend set in the invented land of Tir Tanagiri. Sulien ap Gwien, a young woman whose family is attacked by raiding Jarnsmen, takes up arms and rises through the cavalry of Urdo, the high king trying to unite Tir Tanagiri's warring kingdoms under one peace. The story continues in The King's Name, while The Prize in the Game serves as a prequel exploring the same world's earlier history.

                • Cover of The Acacia Trilogy
                  The Acacia Trilogy

                  series · 3 books · 2007

                  similar bypolitical intriguesecondary worldfantasydarkwar+1 more

                  Acacia: The War with the Mein begins with an empire's ruling Akaran children fleeing after assassins from an exiled people kill their father, scattering the heirs into a wider world whose comfortable myths — and the drug trade and slavery underwriting the empire's peace — turn out to be far uglier than they were raised to believe. David Anthony Durham's trilogy, continuing through The Other Lands and The Sacred Band, follows the siblings as each confronts a different piece of the empire's hidden machinery.

                • Cover of Throne of Glass
                  Throne of Glass

                  series · 15 books · 2012

                  similar bysecondary world+4 more

                  Throne of Glass is a epic fantasy novel series by American author Sarah J. Maas, beginning with the entry of the same name, released on August 2, 2012. The story follows the journey of Celaena Sardothien, a teenage assassin in a corrupt kingdom with a tyrannical ruler, the King of Adarlan. As the story progresses, Celaena forms unexpected bonds and uncovers a conspiracy amidst her adventures. The series concluded with the eighth book in October 2018.

                • Cover of The Green Bone Saga
                  The Green Bone Saga

                  series · 5 books · 2017

                  similar bypolitical intriguefantasysecondary worldtense+2 more

                  Jade City opens Fonda Lee's Green Bone Saga, following the Kaul family, leaders of one of two rival jade-dealing crime clans on the island nation of Kekon, where magic jade grants enhanced abilities to trained warriors and its trade underpins the whole social order. The series follows the Kaul siblings across decades as their clan's power is challenged from within and without, blending gangster-family drama with epic fantasy. It runs across three novels plus shorter companion works.

                • Cover of Black Wolves Trilogy
                  Black Wolves Trilogy

                  series · 1 book · 2015

                  similar bypolitical intriguefantasysecondary worlddarktensewar

                • TS
                  The Second Apocalypse

                  series · 11 books · 2003

                  similar bypolitical intriguesecondary worldfantasydarkwargrimdark

                • Cover of The Immortals
                  The Immortals

                  series · 6 books · 1992

                  part of Tortall

                  similar byfantasysecondary world+1 more

                  Tamora Pierce's Immortals quartet follows Daine, a young woman whose 'wild magic' lets her communicate with and shapeshift among animals, as she's drawn into the kingdom of Tortall's defense against immortal creatures -- griffins, dragons and darker things -- released back into the world after centuries sealed away. Beginning with Wild Magic, the four books pair Daine's personal coming-of-age with an escalating magical threat, and connect to Pierce's earlier Song of the Lioness quartet through several shared characters.

                • Cover of Red Queen
                  Red Queen

                  series · 14 books · 2015

                  similar byfantasysecondary worlddarktense+2 more

                  Red Queen is set in a world split between Reds, an oppressed servant class, and Silvers, a ruling class with superhuman abilities, where a Red girl discovers she has Silver-like powers of her own and is forced into the royal court to hide what she is. Victoria Aveyard's debut novel opens a four-book main sequence - Red Queen, Glass Sword, King's Cage, War Storm - plus the interstitial novella Cruel Crown and the epilogue novella Broken Throne. It's YA dystopian fantasy built around a class-based magic system and a slow-burn political rebellion.

                • Cover of An Ember in the Ashes
                  An Ember in the Ashes

                  series · 4 books · 2015

                  similar byfantasysecondary worldtense+3 more

                  An Ember in the Ashes, set in a fantasy world modeled on ancient Rome, alternates between Laia, who spies on a brutal military academy for rebels in exchange for help freeing her imprisoned brother, and Elias, one of that academy's most skilled soldiers trying to break free of the empire he's been raised to serve. Sabaa Tahir's quartet, continuing through A Torch Against the Night, A Reaper at the Gates, and A Sky Beyond the Storm, follows the two toward a reckoning with the empire that trained one of them to enforce it.