Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Fairy Secrets

anchored on:fantasyour worldcontemporary

but
Narrow·
  • Cover of Boggart
    BoggartSeries

    series · 3 books · 1993

    Set in british isles.

    “Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.”

    from the catalogue
    Start with The Boggart →

    similar byfantasywhimsicalfaecontemporarylighthearted+3 more

  • Cover of Philippa Fisher
    Philippa FisherSeries

    series · 3 books · 2008

    Fantasy, whimsical and lighthearted in tone, about fae and friendship, set in contemporary and our world.

    “Embarrassed by her free-spirited parents and lonely when her best friend moves away, a self-conscious eleven-year-old girl named Philippa summons a wish-granting fairy godmother, with unexpected results.”

    from the catalogue
    Start with Philippa Fisher's Fairy Godsister →

    similar byfantasywhimsicalfaefriendshipcontemporaryour worldlighthearted

  • Cover of David and the Phoenix
    David and the PhoenixNovel

    Edward Ormondroyd · standalone novel · 1957

    Adventure.

    similar byfantasywhimsicalfriendshipour worldcontemporary+1 more

  • Cover of The Halloween Tree
    The Halloween TreeNovel

    Ray Bradbury · standalone novel · 1972

    Adventure, about coming of age and grief and loss.

    “Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life.”

    from the catalogue

    similar byfantasywhimsicalfriendshipour worldcontemporary

  • Cover of Catwings
    CatwingsSeries

    series · 7 books · 1988

    completed

    About coming of age.

    “Catwings is also the title of the first book in the series.”

    from the catalogue
    Start with Catwings →

    similar byfantasyour worldcontemporarylightheartedchildren+2 more

  • Cover of Five Children Universe
    Five Children UniverseSeries

    series · 27 books · 1902

    completed

    Set in early 20th century and british isles.

    “Neither book is by Nesbit herself, and the two have no direct connection to each other beyond both drawing on her creation.”

    from the catalogue
    Start with Five Children and It →

    similar byfantasy+4 more