Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Hell

anchored on:fantasygrimdarksecondary worlddarksurvivalwar+2 more

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories in which extraterrestrial beings are central — as characters, cultures, or the object of the plot.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories about mourning — living through the death of a loved one and what loss does to the survivors.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of Malazan Book of the Fallen
                  Malazan Book of the Fallen

                  series · 20 books · 1999

                  part of Malazan

                  similar bywardarksecondary worldfantasygrimdark+3 more

                  The Malazan Book of the Fallen is a series of epic fantasy novels written by the Canadian author Steven Erikson. The series, published by Bantam Books in the U.K. and Tor Books in the U.S., consists of ten volumes, beginning with Gardens of the Moon (1999) and concluding with The Crippled God (2011). Erikson's series presents the narratives of a large cast of characters spanning thousands of years across multiple continents.

                • Cover of The Poppy War
                  The Poppy War

                  series · 4 books · 2018

                  similar bywardarkgrimdarktensesecondary worldfantasy

                  The Poppy War follows Rin, a war orphan who tests into an elite military academy and discovers a talent for shamanic power tied to a pantheon of vengeful gods. R. F. Kuang's trilogy reworks the Second Sino-Japanese War and its atrocities into an epic fantasy that grows darker and more morally compromised as it goes. It's told across The Poppy War, The Dragon Republic, and The Burning God.

                • Cover of A Song of Ice and Fire
                  A Song of Ice and Fire

                  series · 14 books · 1996

                  part of World of Ice and Fire

                  similar bywardarkfantasysecondary world+2 more

                  A Song of Ice and Fire is a series of high fantasy novels by the American author George R. R. Martin. Martin began writing the first volume, A Game of Thrones, in 1991, and published it in 1996. Martin, who originally envisioned the series as a trilogy, has released five out of seven planned volumes. The most recent entry in the series, A Dance with Dragons, was published in 2011. Since then, Martin has been working on the sixth novel, titled The Winds of Winter. A seventh novel, A Dream of Spring, is planned to follow.

                • Cover of Malazan
                  Malazan

                  universe · 36 books · 1999

                  Start hereMalazan Book of the Fallen · Start here

                  similar bywardarksecondary world+3 more

                  Pity the historian who tries to map this world; pity more the god who thinks he rules it. The Malazan Empire marches across continents on the boots of its common soldiers, and above them move Ascendants — mortals grown into something like gods, and gods worn thin as old coin. Magic is drawn from Warrens, roads of power threaded through reality; the dead keep their grudges; and every empire, however vast, is a wager against time. This is epic fantasy told from the mud, where a sapper cracking a joke weighs as much as an immortal settling a feud older than the human race. The world began as a tabletop campaign two friends built in the 1980s, and it still moves by two hands. Steven Erikson's ten-volume Malazan Book of the Fallen is the spine — Gardens of the Moon, Deadhouse Gates, Memories of Ice, on through The Crippled God — each book a near-standalone campaign that only later reveals how it locks together. Ian C. Esslemont walks the same years from a different vantage in his Novels of the Malazan Empire (Night of Knives, Return of the Crimson Guard onward). Around them stand the prequels: Erikson's Kharkanas Trilogy, archaic and elegiac, chronicling a doomed elder people, and Esslemont's brisker Path to Ascendancy, following two adventurers before they became legends. Erikson's Witness sequence carries the tale forward, and novellas of the genial necromancers Bauchelain and Korbal Broach supply the gallows comedy. Nothing is explained to you; comprehension is earned, and that is the pleasure. The themes run deep — compassion set against cruelty, the toll empires charge, civilizations that fall and are mourned. Begin where the saga does, with Erikson's Gardens of the Moon, and read the ten in publication order; the prequels are for the already-initiated. Trust that confusion is the price of entry.

                • Cover of The Age of Ravens
                  The Age of Ravens

                  series · 2 books · 2019

                  similar bywardarkfantasytensegrimdarksecondary world

                • Cover of The City (Gemmell)
                  The City (Gemmell)

                  series · 2 books · 2013

                  similar bywardarktensegrimdarkfantasysecondary worldbig city

                • TS
                  The Second Apocalypse

                  series · 9 books · 2003

                  similar bywardarkgrimdarkfantasysecondary world

                • Cover of Fire City
                  Fire City

                  Bali Rai · standalone novel · 2012

                  similar bysurvivalwardarkfantasytensesecondary worldbig city

                  Twenty-five years ago the world changed forever. A great war, which had raged for three years ended, and the reign of the Demons began ... Within the crumbling walls of Fire City, fifteen-year-old Martha is a member of the resistance, a small band of humans fighting for freedom in a lawless and horrifying new world. Amidst the chaos of battle arrives Jonah, a handsome stranger with a thirst for revenge and a power to destroy the Demon rulers. As Martha and Jonah's lives collide, the future of the resistance is altered forever. The battle for humankind will now begin ... This is an epic story of catastrophe, survival and the power of humanity.

                • Cover of The Builders
                  The Builders

                  Daniel Polansky · standalone novel · 2015

                  similar bywardarkfantasytensegrimdarksecondary world+1 more

                  A missing eye. A broken wing. A stolen country. The last job didn't end well. Years go by, and scars fade, but memories only fester. For the animals of the Captain's company, survival has meant keeping a low profile, building a new life, and trying to forget the war they lost. But now the Captain's whiskers are twitching at the idea of evening the score.

                • Cover of The Scholomance
                  The Scholomance

                  series · 3 books · 2020

                  similar bysurvivalfantasydarktensesecondary world

                  The Scholomance Trilogy is a series of three fantasy novels written by American author Naomi Novik. The books follow the adventures of Galadriel "El" Higgins during and after attending a dangerous and magical boarding school for wizards named after the magic school Scholomance from Romanian folklore.

                • Cover of Black Wolves Trilogy
                  Black Wolves Trilogy

                  series · 1 book · 2015

                  similar bywarfantasydarktensesecondary world

                • Cover of The Tide Child Trilogy
                  The Tide Child Trilogy

                  series · 3 books · 2019

                  similar bywardarkfantasysecondary world+2 more

                  The Tide Child trilogy is a series of fantasy novels by R. J. Barker. It comprises The Bone Ships (2019), Call of the Bone Ships (2020), and The Bone Ship's Wake (2021). The first book in the trilogy won the 2020 British Fantasy Award for Best Novel.

                • Cover of Fallen Gods / Godkiller
                  Fallen Gods / Godkiller

                  series · 3 books · 2023

                  similar bywartensedarksecondary world+2 more

                  Hannah Kaner's Godkiller follows Kissen, who lost her family to zealots of a fire god and now kills gods for a living, until she meets Skedi, a small god of white lies bound against his will to a young noble and hunted by assassins. Joined by a disillusioned knight on his own secret errand, the mismatched trio travels to the ruined city of Blenraden, where the last wild gods linger, each seeking a favour amid a rising civil war. Sunbringer and Faithbreaker continue their story.

                • Cover of The Nikolai Duology
                  The Nikolai Duology

                  series · 2 books · 2019

                  part of Grishaverse

                  similar byfantasywartensedarksecondary world

                  Leigh Bardugo's Nikolai Duology picks up Nikolai Lantsov and Zoya Nazyalensky from her earlier Grishaverse trilogy set in Ravka, now dealing with the kingdom's fallout as king and general, and adds Nina Zenik from the Six of Crows spin-off working a mission out of Ketterdam. King of Scars and its sequel Rule of Wolves tie together threads from across the wider Grishaverse rather than starting fresh, raising the stakes to a hidden threat inside Nikolai himself. It functions as the convergence point for Bardugo's separate Grishaverse story lines.

                • Cover of Rojan Dizon
                  Rojan Dizon

                  series · 3 books · 2013

                  similar bydarktensefantasysecondary worldbig city+3 more

                • Cover of Dirty Magic
                  Dirty Magic

                  Carol Hughes · standalone novel · 2006

                  similar bysurvivalfantasydarktensesecondary world

                  After his little sister Hannah becomes mortally ill, ten-year-old Joe follows a shadowy figure to the war-torn land of Asphodel, a mysterious and dangerous world of dying children, where he entrusts himself to a devious blind guide, faces ruthless killing machines, and discovers a shocking truth about himself.

                • Cover of Thomas Cale
                  Thomas Cale

                  series · 4 books · 2010

                  similar bywardarksecondary world+3 more

                  Paul Hoffman's Thomas Cale series opens with The Left Hand of God, following a boy raised by a brutal religious military order who escapes into a wider world he's been kept ignorant of. The subsequent books, The Last Four Things, The Beating of His Wings, and The White Devil, follow Cale as the skills that order trained into him make him useful, and dangerous, to larger powers. It's a bleak, war-driven coming-of-age arc rather than a conventional chosen-one fantasy.

                • Cover of Rigante
                  Rigante

                  series · 4 books · 1998

                  completed

                  similar bywardarkfantasysecondary world+2 more

                  Sword in the Storm opens David Gemmell's Rigante sequence, following Connavar, a young tribesman of the Rigante people whose homeland faces both internal clan conflict and the looming threat of a technologically superior empire modeled on Rome. The series spans generations of the Rigante across four novels, mixing Gemmell's trademark heroic-fantasy action with Celtic-flavored history. It was published between 1998 and 2002.

                • Cover of The Lotus War
                  The Lotus War

                  series · 4 books · 2012

                  similar byfantasydarksecondary world+3 more

                  The Lotus War is Jay Kristoff's steampunk fantasy trilogy set in a pollution-choked, Japanese-inspired empire: Stormdancer (2012), Kinslayer and Endsinger, with the novella The Last Stormdancer as a coda. It follows a young woman who tames a griffin-like beast thought extinct, drawing her into a rebellion against the empire's oppressive Shogunate. It is a complete trilogy plus novella.

                • Cover of Shattered Sea
                  Shattered Sea

                  series · 4 books · 2014

                  similar bydarkfantasysecondary world+3 more

                  Shattered Sea is a young adult fantasy series written by the British author Joe Abercrombie. The trilogy was published by Del Rey in the United States and Harper Voyager in the UK.

                • Cover of The Darkness
                  The Darkness

                  series · 6 books · 1999

                  similar bywardarktensefantasysecondary world

                  Darkness, also known as World at War, is a series of six fantasy novels by Harry Turtledove.

                • Cover of Empire of the Vampire
                  Empire of the Vampire

                  series · 3 books · 2021

                  similar bydarktensesecondary worldgrimdark+1 more

                • Cover of The Acacia Trilogy
                  The Acacia Trilogy

                  series · 3 books · 2007

                  similar bywardarkfantasysecondary world+1 more

                  Acacia: The War with the Mein begins with an empire's ruling Akaran children fleeing after assassins from an exiled people kill their father, scattering the heirs into a wider world whose comfortable myths — and the drug trade and slavery underwriting the empire's peace — turn out to be far uglier than they were raised to believe. David Anthony Durham's trilogy, continuing through The Other Lands and The Sacred Band, follows the siblings as each confronts a different piece of the empire's hidden machinery.

                • Cover of The Broken Earth
                  The Broken Earth

                  series · 5 books · 2014

                  similar bysurvivaldarkfantasysecondary world+1 more

                  N. K. Jemisin's Broken Earth trilogy is set on the Stillness, a single supercontinent wracked every few centuries by civilization-ending climate catastrophes called Fifth Seasons. It follows orogenes, people born with the power to move earth and quell earthquakes, who are trained and controlled by the state even as they are feared and despised. The Fifth Season, the opening volume, traces three women revealed to be the same person at different stages of her life, setting up the two sequels that follow her search for her daughter after an orogene shatters the continent.