Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Mirror Magic & Wish Trap

anchored on:fantasywitchescontemporarylightheartedmiddle gradecozy fantasy+2 more

but
Narrow·
  • Cover of The Halloween Tree
    The Halloween TreeNovel

    Ray Bradbury · standalone novel · 1972

    Adventure, about coming of age and grief and loss.

    “Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life.”

    from the catalogue

    similar byour worldcontemporaryfantasyfriendshipwhimsicalmiddle grade

  • Cover of Philippa Fisher
    Philippa FisherSeries

    series · 3 books · 2008

    About fae.

    “Embarrassed by her free-spirited parents and lonely when her best friend moves away, a self-conscious eleven-year-old girl named Philippa summons a wish-granting fairy godmother, with unexpected results.”

    from the catalogue
    Start with Philippa Fisher's Fairy Godsister →

    similar byour worldcontemporaryfantasyfriendshipwhimsicallighthearted+2 more

  • Cover of Matter-of-Fact Magic
    Matter-of-Fact MagicSeries

    series · 10 books · 1969

    completed

    Fantasy, lighthearted and whimsical in tone, about witches, set in our world and contemporary.

    “WorldCat: The arrival of a witch who travels by magic vacuum cleaner is only the beginning of Mary Jane's strange adventures.”

    from the catalogue
    Start with The Wednesday Witch →

    similar byour worldfantasycontemporarylightheartedwitcheswhimsical+1 more

  • Cover of Witch Twins
    Witch TwinsSeries

    series · 4 books · 2001

    Fantasy, lighthearted in tone, about witches, set in contemporary.

    Start with Witch Twins →

    similar bycontemporaryfantasywitcheslightheartedmiddle grade+4 more

  • Cover of The Very Secret Society of Irregular Witches
    The Very Secret Society of Irregular WitchesNovel

    Sangu Mandanna · standalone novel · 2022

    Romance, hopeful in tone, about found family.

    similar byour worldcontemporarywitcheslightheartedcozy fantasyfantasy

  • Cover of Boggart
    BoggartSeries

    series · 3 books · 1993

    About fae, set in british isles.

    “Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.”

    from the catalogue
    Start with The Boggart →

    similar bycontemporaryfantasylightheartedwhimsical+3 more