anchored on:our worldcontemporaryfantasyurban fantasyfriendshipcoming of age+1 more
Diana Wynne Jonesstandalone novel1974
similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsicalfamily secrets+1 more
When a disagreeable man with two boys marries a widow with three children, family adjustments are complicated by two magic chemistry sets which cause strange things to happen around the house.
series7 books1988
completed
similar bycontemporarylightheartedfantasycoming of ageour worldchildren+2 more
Catwings is a series of four American children's picture books written by Ursula K. Le Guin, illustrated by S. D. Schindler, and originally published by Scholastic from 1988 to 1999. It follows the adventures of kittens who were born with wings. Catwings is also the title of the first book in the series. The series is in print from Scholastic as of August 2015.
Ray Bradburystandalone novel1972
similar bycontemporaryfantasyfriendshipcoming of ageour worldwhimsical
Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life. A strange, black-robed guide named Moundshroud appears to lead the boys after him, and the chase turns into a journey through the history of the holiday itself: ancient Egypt, druidic Britain, Rome, medieval Paris, and the Mexican Day of the Dead, each stop peeling back another layer of how humanity has faced death and the dark. Ray Bradbury's Halloween novel doubles as a compressed history of the holiday's origins.
Patrick Nessstandalone novel2015
similar bycontemporaryfantasyurban fantasyfriendshipcoming of ageour worldyoung adultsmall town
What if you aren't the Chosen One? The one who's supposed to fight the zombies, or the soul-eating ghosts, or whatever the heck this new thing is, with the blue lights and the death? What if you're like Mikey? Who just wants to graduate and go to prom and maybe finally work up the courage to ask Henna out before someone goes and blows up the high school. Again. Because sometimes there are problems bigger than this week's end of the world, and sometimes you just have to find the extraordinary in your ordinary life. Even if your best friend is worshipped by mountain lions.
Roald Dahlstandalone novel1961
similar bycontemporaryfantasycoming of ageour worldwhimsical+1 more
James and the Giant Peach is a children's novel written in 1961 by British author Roald Dahl. The first edition, published by Alfred Knopf, featured illustrations by Nancy Ekholm Burkert. There have been re-illustrated versions of it over the years, drawn by Michael Simeon, Emma Chichester Clark, Lane Smith and Quentin Blake. It was adapted into a film of the same name in 1996 which was directed by Henry Selick, and a musical in 2010.
Diana Wynne Jonesstandalone novel1984
similar bycontemporaryurban fantasycoming of agefantasywhimsicalfamily secretschildren+1 more
After the Goon moves into Sykes' house and refuses to budge, thirteen-year-old Howard learns some startling information about his family, including the fact that he is adopted and that his father is connected with seven wizards who run their town.
series6 books1964
completed
similar bycontemporaryfantasycoming of ageour worldwhimsical+1 more
series3 books2008
similar bylightheartedcontemporaryfantasyfriendshipwhimsicalour world+1 more
Ian McEwanstandalone novel1994
similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsicalchildren
The Daydreamer is a 1994 children's novel by British author Ian McEwan. Illustrated by Anthony Browne. The novel was first published by Jonathan Cape. It draws its plot directly from the Rankin/Bass movie, The Daydreamer (1966) in which a young boy daydreams and enters a world of Hans Christian Andersen stories. It is considered to be McEwan's first book for children, or second if taking into account the picture book Rose Blanche (1985). Critics praised McEwan's imagination, but noted that the book had high "sweetness-and-light levels".
Anna-Marie McLemore & Tehlor Kay Mejiastandalone novel2020
similar bycontemporaryfantasyfriendshipcoming of ageour worldwhimsicalyoung adult+1 more
Miss Meteor is a 2020 young adult fantasy novel by Tehlor Kay Mejia and Anna-Marie McLemore.
Justine Larbalestierstandalone novel2008
similar bylightheartedcontemporaryfantasyurban fantasycoming of ageour worldyoung adult+1 more
How to Ditch Your Fairy is a young adult novel by Australian writer Justine Larbalestier. It was published in 2008 by Bloomsbury.
Julia L. Sauerstandalone novel1943
similar bylightheartedcontemporaryfantasycoming of agewhimsicalsmall town+2 more
A Nova Scotian girl's love of the fog brings her happy adventures in a village lost for a hundred years
series3 books1993
similar bylightheartedcontemporaryfantasywhimsical+3 more
Susan Cooper's Boggart series begins with the 1993 novel The Boggart, nominated for a Young Reader's Choice Award, and continues across three further books including The Boggart and the Monster and A Box of Boggarts. Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.
Marissa Meyerstandalone novel2024
similar bylightheartedcontemporaryfantasyfriendshipcoming of ageyoung adultsmall town
Jude is determined to fly under the radar. He just wants to draw his comics, host regular D&D night with his friends, work at his parents’ vinyl record store, and escape high school as unscathed as possible. That is, until the night he comes across a mysterious twenty-sided dice and finds himself inexplicably gifted with a bout of supernatural good luck. Suddenly, everything Jude has ever wanted is within reach. His first art submission is accepted to his favorite fanzine. He helps his friend’s song become a finalist in a songwriting competition. And he’s the 100th caller to a local radio contest, winning him a pair of coveted concert tickets, which he uses to ask out the popular girl he’s been crushing on since elementary school. For a few blissful weeks, he feels invincible. But when he loses the magic dice at a local music festival, his luck takes a turn for the worse. He struggles to reclaim his good fortune while fighting off long-buried feelings for his best friend―who is definitely not the girl he’s supposed to be in love with. Can Jude risk stepping into the spotlight long enough to win the true girl of his dreams? Or is he doomed to be unlucky in love forever?
Gail Carson Levinestandalone novel2000
similar bylightheartedcontemporaryfantasycoming of ageour world+3 more
From copyright page: When granted her wish to be the most popular girl in school, Wilma, an eighth grader, forgets that she will graduate in three weeks and her popularity will vanish.
Zilpha Keatley Snyderstandalone novel1966
similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsical
Twelve-year-old Harry Houdini Marco is awkward and clumsy, bearing little resemblance to his magician namesake, until he acquires the gift of flight.
Lois Lowrystandalone novel2006
similar bycontemporaryfantasyfriendshipcoming of ageour world+2 more
Where do dreams come from? What stealthy nighttime messengers are the guardians of our most deeply hidden hopes and our half-forgotten fears? Drawing on her rich imagination, two-time Newbery winner Lois Lowry confronts these questions and explores the conflicts between the gentle bits and pieces of the past that come to life in dream, and the darker horrors that find their form in nightmare. In a haunting story that tiptoes between reality and imagination, two people — a lonely, sensitive woman and a damaged, angry boy — face their own histories and discover what they can be to one another, renewed by the strength that comes from a tiny, caring creature they will never see.
series4 books2002
similar bycontemporaryfantasyurban fantasycoming of ageour worldyoung adult
Tithe opens Holly Black's Modern Faerie Tales with Kaye Fierch, a teenage drifter who discovers she's a changeling with real faerie blood after returning to her childhood home on the Jersey Shore, and gets pulled into the political violence of the local faerie courts. The trilogy, continuing through Valiant and Ironside, keeps its "suburban fantasy" grounded in ordinary New Jersey settings rather than a storybook otherworld.
series16 books2002
similar bylightheartedcontemporaryfantasyfriendshipour world+2 more
My Secret Unicorn is a series of children's books written by Linda Chapman. The series was first published between 2002 and 2007. The books feature the adventures of Lauren and her unicorn, Twilight, and their friends. Chapman got the inspiration for the series while nannying for a pony-mad seven-year-old in 1994, and in 1998 started writing for Working Partners Ltd. Since then she has had over a hundred books published under various pseudonyms and under her own name.
Neil Gaimanstandalone novel2013
similar bycontemporaryfantasyfriendshipcoming of ageour world
A seven year old farm boy becomes friends with an eleven year old neighbor girl, who he discovers is ancient and powerful and intervenes when a nonhuman entity attempts to make a home in earthly reality.
Edward Ormondroydstandalone novel1957
similar bycontemporaryfantasyfriendshipour worldwhimsical+1 more
David and the Phoenix is a 1957 children's novel about a young boy's adventures with a phoenix. It was the first published book by American children's writer Edward Ormondroyd.
series3 books2007
similar bycontemporaryfantasycoming of ageour world+1 more
The Graveyard Book follows Nobody "Bod" Owens, a toddler who escapes the murder of his family and is raised among the ghosts of an old English graveyard, absorbing their otherworldly customs while a threat from his past waits beyond the gates. Neil Gaiman's 2008 novel won both the Newbery and Carnegie Medals, and illustrator P. Craig Russell later adapted it into a two-volume graphic novel. Bod's story spans the original novel and that graphic-novel retelling rather than continuing in a prose sequel.
Annie Daltonstandalone novel1988
similar bycontemporaryfantasyurban fantasycoming of ageour worldyoung adult+1 more
Fifteen-year-old Molly, who lives in a turbulent, single-parent household, is asked by mysterious, otherworldly visitors to protect an enchanted child from great danger.