Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Rabbitmagic

anchored on:our worldcontemporaryfantasyurban fantasyfriendshipcoming of age+1 more

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories in which extraterrestrial beings are central — as characters, cultures, or the object of the plot.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories about mourning — living through the death of a loved one and what loss does to the survivors.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of The Ogre Downstairs
                  The Ogre Downstairs

                  Diana Wynne Jones · standalone novel · 1974

                  similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsicalfamily secrets+1 more

                  When a disagreeable man with two boys marries a widow with three children, family adjustments are complicated by two magic chemistry sets which cause strange things to happen around the house.

                • Cover of Catwings
                  Catwings

                  series · 7 books · 1988

                  completed

                  similar bycontemporarylightheartedfantasycoming of ageour worldchildren+2 more

                  Catwings is a series of four American children's picture books written by Ursula K. Le Guin, illustrated by S. D. Schindler, and originally published by Scholastic from 1988 to 1999. It follows the adventures of kittens who were born with wings. Catwings is also the title of the first book in the series. The series is in print from Scholastic as of August 2015.

                • Cover of The Halloween Tree
                  The Halloween Tree

                  Ray Bradbury · standalone novel · 1972

                  similar bycontemporaryfantasyfriendshipcoming of ageour worldwhimsical

                  Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life. A strange, black-robed guide named Moundshroud appears to lead the boys after him, and the chase turns into a journey through the history of the holiday itself: ancient Egypt, druidic Britain, Rome, medieval Paris, and the Mexican Day of the Dead, each stop peeling back another layer of how humanity has faced death and the dark. Ray Bradbury's Halloween novel doubles as a compressed history of the holiday's origins.

                • Cover of The Rest of Us Just Live Here
                  The Rest of Us Just Live Here

                  Patrick Ness · standalone novel · 2015

                  similar bycontemporaryfantasyurban fantasyfriendshipcoming of ageour worldyoung adultsmall town

                  What if you aren't the Chosen One? The one who's supposed to fight the zombies, or the soul-eating ghosts, or whatever the heck this new thing is, with the blue lights and the death? What if you're like Mikey? Who just wants to graduate and go to prom and maybe finally work up the courage to ask Henna out before someone goes and blows up the high school. Again. Because sometimes there are problems bigger than this week's end of the world, and sometimes you just have to find the extraordinary in your ordinary life. Even if your best friend is worshipped by mountain lions.

                • Cover of James and the Giant Peach
                  James and the Giant Peach

                  Roald Dahl · standalone novel · 1961

                  similar bycontemporaryfantasycoming of ageour worldwhimsical+1 more

                  James and the Giant Peach is a children's novel written in 1961 by British author Roald Dahl. The first edition, published by Alfred Knopf, featured illustrations by Nancy Ekholm Burkert. There have been re-illustrated versions of it over the years, drawn by Michael Simeon, Emma Chichester Clark, Lane Smith and Quentin Blake. It was adapted into a film of the same name in 1996 which was directed by Henry Selick, and a musical in 2010.

                • Cover of Archer's Goon
                  Archer's Goon

                  Diana Wynne Jones · standalone novel · 1984

                  similar bycontemporaryurban fantasycoming of agefantasywhimsicalfamily secretschildren+1 more

                  After the Goon moves into Sykes' house and refuses to budge, thirteen-year-old Howard learns some startling information about his family, including the fact that he is adopted and that his father is connected with seven wizards who run their town.

                • Cover of Charlie (Roald Dahl)
                  Charlie (Roald Dahl)

                  series · 6 books · 1964

                  completed

                  similar bycontemporaryfantasycoming of ageour worldwhimsical+1 more

                • Cover of Philippa Fisher
                  Philippa Fisher

                  series · 3 books · 2008

                  similar bylightheartedcontemporaryfantasyfriendshipwhimsicalour world+1 more

                • Cover of The Daydreamer
                  The Daydreamer

                  Ian McEwan · standalone novel · 1994

                  similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsicalchildren

                  The Daydreamer is a 1994 children's novel by British author Ian McEwan. Illustrated by Anthony Browne. The novel was first published by Jonathan Cape. It draws its plot directly from the Rankin/Bass movie, The Daydreamer (1966) in which a young boy daydreams and enters a world of Hans Christian Andersen stories. It is considered to be McEwan's first book for children, or second if taking into account the picture book Rose Blanche (1985). Critics praised McEwan's imagination, but noted that the book had high "sweetness-and-light levels".

                • Cover of Miss Meteor
                  Miss Meteor

                  Anna-Marie McLemore & Tehlor Kay Mejia · standalone novel · 2020

                  similar bycontemporaryfantasyfriendshipcoming of ageour worldwhimsicalyoung adult+1 more

                  Miss Meteor is a 2020 young adult fantasy novel by Tehlor Kay Mejia and Anna-Marie McLemore.

                • Cover of How to Ditch Your Fairy
                  How to Ditch Your Fairy

                  Justine Larbalestier · standalone novel · 2008

                  similar bylightheartedcontemporaryfantasyurban fantasycoming of ageour worldyoung adult+1 more

                  How to Ditch Your Fairy is a young adult novel by Australian writer Justine Larbalestier. It was published in 2008 by Bloomsbury.

                • Cover of Fog Magic
                  Fog Magic

                  Julia L. Sauer · standalone novel · 1943

                  similar bylightheartedcontemporaryfantasycoming of agewhimsicalsmall town+2 more

                  A Nova Scotian girl's love of the fog brings her happy adventures in a village lost for a hundred years

                • Cover of Boggart
                  Boggart

                  series · 3 books · 1993

                  similar bylightheartedcontemporaryfantasywhimsical+3 more

                  Susan Cooper's Boggart series begins with the 1993 novel The Boggart, nominated for a Young Reader's Choice Award, and continues across three further books including The Boggart and the Monster and A Box of Boggarts. Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.

                • Cover of With a Little Luck
                  With a Little Luck

                  Marissa Meyer · standalone novel · 2024

                  similar bylightheartedcontemporaryfantasyfriendshipcoming of ageyoung adultsmall town

                  Jude is determined to fly under the radar. He just wants to draw his comics, host regular D&D night with his friends, work at his parents’ vinyl record store, and escape high school as unscathed as possible. That is, until the night he comes across a mysterious twenty-sided dice and finds himself inexplicably gifted with a bout of supernatural good luck. Suddenly, everything Jude has ever wanted is within reach. His first art submission is accepted to his favorite fanzine. He helps his friend’s song become a finalist in a songwriting competition. And he’s the 100th caller to a local radio contest, winning him a pair of coveted concert tickets, which he uses to ask out the popular girl he’s been crushing on since elementary school. For a few blissful weeks, he feels invincible. But when he loses the magic dice at a local music festival, his luck takes a turn for the worse. He struggles to reclaim his good fortune while fighting off long-buried feelings for his best friend―who is definitely not the girl he’s supposed to be in love with. Can Jude risk stepping into the spotlight long enough to win the true girl of his dreams? Or is he doomed to be unlucky in love forever?

                • Cover of The Wish
                  The Wish

                  Gail Carson Levine · standalone novel · 2000

                  similar bylightheartedcontemporaryfantasycoming of ageour world+3 more

                  From copyright page: When granted her wish to be the most popular girl in school, Wilma, an eighth grader, forgets that she will graduate in three weeks and her popularity will vanish.

                • Cover of Black and Blue Magic
                  Black and Blue Magic

                  Zilpha Keatley Snyder · standalone novel · 1966

                  similar bylightheartedcontemporaryfantasycoming of ageour worldwhimsical

                  Twelve-year-old Harry Houdini Marco is awkward and clumsy, bearing little resemblance to his magician namesake, until he acquires the gift of flight.

                • Cover of Gossamer
                  Gossamer

                  Lois Lowry · standalone novel · 2006

                  similar bycontemporaryfantasyfriendshipcoming of ageour world+2 more

                  Where do dreams come from? What stealthy nighttime messengers are the guardians of our most deeply hidden hopes and our half-forgotten fears? Drawing on her rich imagination, two-time Newbery winner Lois Lowry confronts these questions and explores the conflicts between the gentle bits and pieces of the past that come to life in dream, and the darker horrors that find their form in nightmare. In a haunting story that tiptoes between reality and imagination, two people — a lonely, sensitive woman and a damaged, angry boy — face their own histories and discover what they can be to one another, renewed by the strength that comes from a tiny, caring creature they will never see.

                • Cover of Modern Tale of Faerie
                  Modern Tale of Faerie

                  series · 4 books · 2002

                  similar bycontemporaryfantasyurban fantasycoming of ageour worldyoung adult

                  Tithe opens Holly Black's Modern Faerie Tales with Kaye Fierch, a teenage drifter who discovers she's a changeling with real faerie blood after returning to her childhood home on the Jersey Shore, and gets pulled into the political violence of the local faerie courts. The trilogy, continuing through Valiant and Ironside, keeps its "suburban fantasy" grounded in ordinary New Jersey settings rather than a storybook otherworld.

                • Cover of My Secret Unicorn
                  My Secret Unicorn

                  series · 16 books · 2002

                  similar bylightheartedcontemporaryfantasyfriendshipour world+2 more

                  My Secret Unicorn is a series of children's books written by Linda Chapman. The series was first published between 2002 and 2007. The books feature the adventures of Lauren and her unicorn, Twilight, and their friends. Chapman got the inspiration for the series while nannying for a pony-mad seven-year-old in 1994, and in 1998 started writing for Working Partners Ltd. Since then she has had over a hundred books published under various pseudonyms and under her own name.

                • Cover of The Ocean at the End of the Lane
                  The Ocean at the End of the Lane

                  Neil Gaiman · standalone novel · 2013

                  similar bycontemporaryfantasyfriendshipcoming of ageour world

                  A seven year old farm boy becomes friends with an eleven year old neighbor girl, who he discovers is ancient and powerful and intervenes when a nonhuman entity attempts to make a home in earthly reality.

                • Cover of David and the Phoenix
                  David and the Phoenix

                  Edward Ormondroyd · standalone novel · 1957

                  similar bycontemporaryfantasyfriendshipour worldwhimsical+1 more

                  David and the Phoenix is a 1957 children's novel about a young boy's adventures with a phoenix. It was the first published book by American children's writer Edward Ormondroyd.

                • Cover of Bod Owens
                  Bod Owens

                  series · 3 books · 2007

                  similar bycontemporaryfantasycoming of ageour world+1 more

                  The Graveyard Book follows Nobody "Bod" Owens, a toddler who escapes the murder of his family and is raised among the ghosts of an old English graveyard, absorbing their otherworldly customs while a threat from his past waits beyond the gates. Neil Gaiman's 2008 novel won both the Newbery and Carnegie Medals, and illustrator P. Craig Russell later adapted it into a two-volume graphic novel. Bod's story spans the original novel and that graphic-novel retelling rather than continuing in a prose sequel.

                • Cover of Sticker Girl
                  Sticker Girl

                  series · 3 books · 2016

                  similar bycontemporarylightheartedfantasyfriendshipour world+3 more

                • Cover of Out of the Ordinary
                  Out of the Ordinary

                  Annie Dalton · standalone novel · 1988

                  similar bycontemporaryfantasyurban fantasycoming of ageour worldyoung adult+1 more

                  Fifteen-year-old Molly, who lives in a turbulent, single-parent household, is asked by mysterious, otherworldly visitors to protect an enchanted child from great danger.