Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like The Saci

anchored on:fantasylatin americacontemporarywhimsicalmythic fantasyfae+4 more

but
Narrow·
  • Cover of James and the Giant Peach
    James and the Giant PeachNovel

    Roald Dahl · standalone novel · 1961

    About found family, set in our world.

    “There have been re-illustrated versions of it over the years, drawn by Michael Simeon, Emma Chichester Clark, Lane Smith and Quentin Blake.”

    from the catalogue

    similar bycontemporaryfantasywhimsicaladventurouscoming of age+1 more

  • Cover of Eight Days of Luke
    Eight Days of LukeNovel

    Diana Wynne Jones · standalone novel · 1975

    About gods, set in british isles.

    similar bycontemporaryfantasymythic fantasywhimsicalcoming of age+3 more

  • Cover of The Ocean at the End of the Lane
    The Ocean at the End of the LaneNovel

    Neil Gaiman · standalone novel · 2013

    Dark fantasy, eerie in tone, set in our world.

    “A seven year old farm boy becomes friends with an eleven year old neighbor girl, who he discovers is ancient and powerful and intervenes when a nonhuman entity attempts to make a home in earthly reality.”

    from the catalogue

    similar bycontemporaryfantasyfaefriendshipcoming of agecountryside & village

  • Cover of The Dark Is Rising
    The Dark Is RisingSeries

    series · 5 books · 1965

    Set in british isles.

    “The first book in the series, Over Sea, Under Stone, was originally conceived as a stand-alone novel, and the sequence gets its name from the second novel in the series, The Dark Is Rising.”

    from the catalogue
    Start with Over Sea, Under Stone →

    similar bycontemporaryfantasymythic fantasyadventurous+3 more

  • Cover of Summerland
    SummerlandNovel

    Michael Chabon · standalone novel · 2002

    Portal fantasy, about quests, set in parallel universe.

    “Summerland weaves elements of a World Series, parallel-universe road trip, and a hero's odyssey.”

    from the catalogue

    similar bycontemporaryfantasyadventurouswhimsicalcoming of ageyoung adult+1 more

  • Cover of The Halloween Tree
    The Halloween TreeNovel

    Ray Bradbury · standalone novel · 1972

    Adventure, about grief and loss, set in our world.

    “Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life.”

    from the catalogue

    similar bycontemporaryfantasywhimsicalfriendshipcoming of agemiddle grade