Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Trolled

anchored on:fantasycontemporarymiddle gradeidentitybig citylighthearted+1 more

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories centered on witches and the practice of witchcraft — covens, hedge magic, familiars, and the witch's place in her community.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories about mourning — living through the death of a loved one and what loss does to the survivors.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of Black and Blue Magic
                  Black and Blue Magic

                  Zilpha Keatley Snyder · standalone novel · 1966

                  similar byfantasycontemporaryidentitylightheartedwhimsicalmiddle grade

                  Twelve-year-old Harry Houdini Marco is awkward and clumsy, bearing little resemblance to his magician namesake, until he acquires the gift of flight.

                • Cover of Un Lun Dun
                  Un Lun Dun

                  China Miéville · standalone novel · 2007

                  similar byfantasybig citycontemporarywhimsicaltransported to another world

                  Un Lun Dun is a young adult fantasy novel by China Miéville, released in 2007. The title is derived from 'UnLondon,' the name of the alternate realm where the book is set. It also contains illustrations by Miéville. It was first released in January 2007. The novel also won the 2008 Locus Award for Best Young Adult Book.

                • Cover of Tucker & Harry
                  Tucker & Harry

                  series · 8 books · 1960

                  completed

                  similar byfantasybig citycontemporarylightheartedwhimsicalfriendship

                • Cover of The Halloween Tree
                  The Halloween Tree

                  Ray Bradbury · standalone novel · 1972

                  similar byfantasycontemporarywhimsicalfriendshipmiddle grade

                  Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life. A strange, black-robed guide named Moundshroud appears to lead the boys after him, and the chase turns into a journey through the history of the holiday itself: ancient Egypt, druidic Britain, Rome, medieval Paris, and the Mexican Day of the Dead, each stop peeling back another layer of how humanity has faced death and the dark. Ray Bradbury's Halloween novel doubles as a compressed history of the holiday's origins.

                • Cover of London Below
                  London Below

                  series · 5 books · 1996

                  similar byfantasybig citycontemporarytransported to another world+1 more

                  Neil Gaiman's Neverwhere (1996) follows Richard Mayhew, an ordinary Londoner who stops to help an injured girl and is pulled out of everyday London into London Below, a hidden, magical underworld of forgotten places and strange factions existing alongside the city he knew. The novel began life as a BBC television series before Gaiman reworked it into this stand-alone book.

                • Cover of Boggart
                  Boggart

                  series · 3 books · 1993

                  similar byfantasycontemporarylightheartedwhimsical+2 more

                  Susan Cooper's Boggart series begins with the 1993 novel The Boggart, nominated for a Young Reader's Choice Award, and continues across three further books including The Boggart and the Monster and A Box of Boggarts. Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.

                • Cover of The Starless Sea
                  The Starless Sea

                  Erin Morgenstern · standalone novel · 2019

                  similar byfantasycontemporaryidentitywhimsical+1 more

                  The Starless Sea is a 2019 speculative fiction novel by Erin Morgenstern. It is her second book, following the best-selling The Night Circus, which was published in 2011. The novel reached number three on The New York Times Best Seller list, and was also a Los Angeles Times and Sunday Times bestseller.

                • Cover of Fog Magic
                  Fog Magic

                  Julia L. Sauer · standalone novel · 1943

                  similar byfantasycontemporarylightheartedwhimsicaltransported to another world+1 more

                  A Nova Scotian girl's love of the fog brings her happy adventures in a village lost for a hundred years

                • Cover of Starring Prima! : The Mouse of the Ballet Jolie
                  Starring Prima! : The Mouse of the Ballet Jolie

                  Jacquelyn Mitchard · standalone novel · 2004

                  similar byfantasybig citycontemporarylightheartedwhimsical+1 more

                  In the old grand piano at the Ballet Jolie in New York City lives a ballet dancer who just happens to be a mouse, and who intends to become principal dancer in ballets for mice and humans, and the occasional dog, as well.

                • Cover of Stuart Little
                  Stuart Little

                  E. B. White · standalone novel · 1945

                  similar byfantasyidentitywhimsical+3 more

                  Stuart Little is a 1945 American children's novel by E. B. White. It was White's first children's book, and became recognized as a classic in children's literature. Stuart Little was illustrated by the artist Garth Williams, also his first work for children.

                • Cover of Philippa Fisher
                  Philippa Fisher

                  series · 3 books · 2008

                  similar byfantasycontemporarywhimsicallightheartedfriendship+1 more

                • Cover of Bob
                  Bob

                  Wendy Mass & Rebecca Stead · standalone novel · 2018

                  similar byfantasycontemporaryidentitywhimsicalfriendshipmiddle grade

                  About young Livy who comes to stay with her grandmother in Australia. In her wardrobe she finds a strange creature called Bob who tells her she told him to stay in the wardrobe until she came back. That was five long years ago and faithful Bob has stayed put just as she asked. Neither Bob nor Livy know who Bob is or where his family is and the story is all about how they puzzle out how Bob got to Livy's wardrobe and how they get him back where he belongs.

                • Cover of The Enchanted Files
                  The Enchanted Files

                  series · 3 books · 2015

                  similar byfantasycontemporarymiddle grade+5 more

                • Cover of Miss Meteor
                  Miss Meteor

                  Anna-Marie McLemore & Tehlor Kay Mejia · standalone novel · 2020

                  similar byfantasycontemporaryidentitywhimsicalfriendship

                  Miss Meteor is a 2020 young adult fantasy novel by Tehlor Kay Mejia and Anna-Marie McLemore.

                • Cover of Kraken: An Anatomy
                  Kraken: An Anatomy

                  China Miéville · standalone novel · 2010

                  similar byfantasybig citycontemporarywhimsical+1 more

                  Kraken is a fantasy novel by British author China Miéville. It is published in the UK by Macmillan, and in the US by Del Rey Books. The book bears the subtitle "An Anatomy" on the title page. It was the winner for the 2011 Locus Award for Best Fantasy Novel. Miéville has described the book as "a dark comedy about a squid-worshipping cult and the end of the world. It takes the idea of the squid cult very seriously. Part of the appeal of the fantastic is taking ridiculous ideas very seriously and pretending they’re not absurd."

                • Cover of Chrestomanci
                  Chrestomanci

                  series · 12 books · 1977

                  completed

                  similar byfantasycontemporarywhimsicalmiddle grade

                  Chrestomanci, sometimes branded The Worlds of Chrestomanci, is a heptalogy of children's fantasy books written by British author Diana Wynne Jones, published from 1977 to 2006. In the context of the parallel universe setting of the books, Chrestomanci refers to both the British government office that is responsible for supervising the use of magic and Chrestomanci Castle in southern England, which is both residence and headquarters.

                • Cover of The Fairy Rebel
                  The Fairy Rebel

                  Lynne Reid Banks · standalone novel · 1985

                  similar byfantasycontemporarylightheartedwhimsicalfriendship

                  A rebellious fairy named Tiki, already in trouble for breaking the rule against wearing jeans, risks the further wrath of the Fairy Queen by trying to fulfill a human's special request for help.

                • Cover of Madame Pamplemousse
                  Madame Pamplemousse

                  series · 3 books · 2008

                  similar byfantasycontemporarywhimsicalmiddle grade+3 more

                • Cover of How to Ditch Your Fairy
                  How to Ditch Your Fairy

                  Justine Larbalestier · standalone novel · 2008

                  similar byfantasycontemporaryidentitylighthearted+2 more

                  How to Ditch Your Fairy is a young adult novel by Australian writer Justine Larbalestier. It was published in 2008 by Bloomsbury.

                • Cover of The Wind in the Willows Universe
                  The Wind in the Willows Universe

                  series · 17 books · 1908

                  similar byfantasyfriendship+2 more

                • Cover of Coyote Blue
                  Coyote Blue

                  Christopher Moore · standalone novel · 1994

                  similar byfantasycontemporaryidentitywhimsical+1 more

                  Coyote Blue is a novel by American writer Christopher Moore, published in 1994. It has been widely reviewed.

                • Cover of Gods Behaving Badly
                  Gods Behaving Badly

                  Marie Phillips · standalone novel · 2007

                  similar byfantasybig citycontemporarywhimsical

                  Gods Behaving Badly is a novel by the British author Marie Phillips. It was first published by Jonathan Cape in 2007. Set in London, it tells the tale of the twelve gods of Mount Olympus living in a rundown flat as their powers wane. It was selected for The Atlantic's 1book140 Twitter book club's book of the month for August 2011.

                • Cover of Tales of Magic
                  Tales of Magic

                  series · 7 books · 1954

                  completed

                  similar byfantasywhimsicalcontemporaryfriendship+2 more

                  Tales of Magic collects Edward Eager's seven loosely connected children's novels about ordinary kids who stumble into magic in everyday American settings, starting with Half Magic, in which four siblings find a coin that grants exactly half of any wish. Each book follows a different, sometimes overlapping set of children and a different magical object or rule, from Knight's Castle to the deliberately ambiguous Magic or Not? and its sequel The Well-Wishers. Eager wrote them as a direct homage to E. Nesbit, sometimes having his own child characters read her books.

                • Cover of Matter-of-Fact Magic
                  Matter-of-Fact Magic

                  series · 10 books · 1969

                  completed

                  similar byfantasycontemporarylightheartedwhimsical+1 more