anchored on:fantasycontemporarymiddle gradeidentitybig citylighthearted+1 more
Zilpha Keatley Snyderstandalone novel1966
similar byfantasycontemporaryidentitylightheartedwhimsicalmiddle grade
Twelve-year-old Harry Houdini Marco is awkward and clumsy, bearing little resemblance to his magician namesake, until he acquires the gift of flight.
China Miévillestandalone novel2007
similar byfantasybig citycontemporarywhimsicaltransported to another world
Un Lun Dun is a young adult fantasy novel by China Miéville, released in 2007. The title is derived from 'UnLondon,' the name of the alternate realm where the book is set. It also contains illustrations by Miéville. It was first released in January 2007. The novel also won the 2008 Locus Award for Best Young Adult Book.
series8 books1960
completed
similar byfantasybig citycontemporarylightheartedwhimsicalfriendship
Ray Bradburystandalone novel1972
similar byfantasycontemporarywhimsicalfriendshipmiddle grade
Eight boys gather on Halloween night to trick-or-treat with their ninth friend, Pipkin, only Pipkin never shows, having vanished on some errand that may cost him his life. A strange, black-robed guide named Moundshroud appears to lead the boys after him, and the chase turns into a journey through the history of the holiday itself: ancient Egypt, druidic Britain, Rome, medieval Paris, and the Mexican Day of the Dead, each stop peeling back another layer of how humanity has faced death and the dark. Ray Bradbury's Halloween novel doubles as a compressed history of the holiday's origins.
series5 books1996
similar byfantasybig citycontemporarytransported to another world+1 more
Neil Gaiman's Neverwhere (1996) follows Richard Mayhew, an ordinary Londoner who stops to help an injured girl and is pulled out of everyday London into London Below, a hidden, magical underworld of forgotten places and strange factions existing alongside the city he knew. The novel began life as a BBC television series before Gaiman reworked it into this stand-alone book.
series3 books1993
similar byfantasycontemporarylightheartedwhimsical+2 more
Susan Cooper's Boggart series begins with the 1993 novel The Boggart, nominated for a Young Reader's Choice Award, and continues across three further books including The Boggart and the Monster and A Box of Boggarts. Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.
Erin Morgensternstandalone novel2019
similar byfantasycontemporaryidentitywhimsical+1 more
The Starless Sea is a 2019 speculative fiction novel by Erin Morgenstern. It is her second book, following the best-selling The Night Circus, which was published in 2011. The novel reached number three on The New York Times Best Seller list, and was also a Los Angeles Times and Sunday Times bestseller.
Julia L. Sauerstandalone novel1943
similar byfantasycontemporarylightheartedwhimsicaltransported to another world+1 more
A Nova Scotian girl's love of the fog brings her happy adventures in a village lost for a hundred years
Jacquelyn Mitchardstandalone novel2004
similar byfantasybig citycontemporarylightheartedwhimsical+1 more
In the old grand piano at the Ballet Jolie in New York City lives a ballet dancer who just happens to be a mouse, and who intends to become principal dancer in ballets for mice and humans, and the occasional dog, as well.
E. B. Whitestandalone novel1945
similar byfantasyidentitywhimsical+3 more
Stuart Little is a 1945 American children's novel by E. B. White. It was White's first children's book, and became recognized as a classic in children's literature. Stuart Little was illustrated by the artist Garth Williams, also his first work for children.
Wendy Mass & Rebecca Steadstandalone novel2018
similar byfantasycontemporaryidentitywhimsicalfriendshipmiddle grade
About young Livy who comes to stay with her grandmother in Australia. In her wardrobe she finds a strange creature called Bob who tells her she told him to stay in the wardrobe until she came back. That was five long years ago and faithful Bob has stayed put just as she asked. Neither Bob nor Livy know who Bob is or where his family is and the story is all about how they puzzle out how Bob got to Livy's wardrobe and how they get him back where he belongs.
Anna-Marie McLemore & Tehlor Kay Mejiastandalone novel2020
similar byfantasycontemporaryidentitywhimsicalfriendship
Miss Meteor is a 2020 young adult fantasy novel by Tehlor Kay Mejia and Anna-Marie McLemore.
China Miévillestandalone novel2010
similar byfantasybig citycontemporarywhimsical+1 more
Kraken is a fantasy novel by British author China Miéville. It is published in the UK by Macmillan, and in the US by Del Rey Books. The book bears the subtitle "An Anatomy" on the title page. It was the winner for the 2011 Locus Award for Best Fantasy Novel. Miéville has described the book as "a dark comedy about a squid-worshipping cult and the end of the world. It takes the idea of the squid cult very seriously. Part of the appeal of the fantastic is taking ridiculous ideas very seriously and pretending they’re not absurd."
series12 books1977
completed
similar byfantasycontemporarywhimsicalmiddle grade
Chrestomanci, sometimes branded The Worlds of Chrestomanci, is a heptalogy of children's fantasy books written by British author Diana Wynne Jones, published from 1977 to 2006. In the context of the parallel universe setting of the books, Chrestomanci refers to both the British government office that is responsible for supervising the use of magic and Chrestomanci Castle in southern England, which is both residence and headquarters.
Lynne Reid Banksstandalone novel1985
similar byfantasycontemporarylightheartedwhimsicalfriendship
A rebellious fairy named Tiki, already in trouble for breaking the rule against wearing jeans, risks the further wrath of the Fairy Queen by trying to fulfill a human's special request for help.
Justine Larbalestierstandalone novel2008
similar byfantasycontemporaryidentitylighthearted+2 more
How to Ditch Your Fairy is a young adult novel by Australian writer Justine Larbalestier. It was published in 2008 by Bloomsbury.
Christopher Moorestandalone novel1994
similar byfantasycontemporaryidentitywhimsical+1 more
Coyote Blue is a novel by American writer Christopher Moore, published in 1994. It has been widely reviewed.
Marie Phillipsstandalone novel2007
similar byfantasybig citycontemporarywhimsical
Gods Behaving Badly is a novel by the British author Marie Phillips. It was first published by Jonathan Cape in 2007. Set in London, it tells the tale of the twelve gods of Mount Olympus living in a rundown flat as their powers wane. It was selected for The Atlantic's 1book140 Twitter book club's book of the month for August 2011.
series7 books1954
completed
similar byfantasywhimsicalcontemporaryfriendship+2 more
Tales of Magic collects Edward Eager's seven loosely connected children's novels about ordinary kids who stumble into magic in everyday American settings, starting with Half Magic, in which four siblings find a coin that grants exactly half of any wish. Each book follows a different, sometimes overlapping set of children and a different magical object or rule, from Knight's Castle to the deliberately ambiguous Magic or Not? and its sequel The Well-Wishers. Eager wrote them as a direct homage to E. Nesbit, sometimes having his own child characters read her books.
series10 books1969
completed
similar byfantasycontemporarylightheartedwhimsical+1 more