Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Third Foreigner Sequence

anchored on:science fictionother star systemsfar future

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories in which extraterrestrial beings are central — as characters, cultures, or the object of the plot.
  • Stories about venturing into space to explore — survey missions, astronauts, and the frontier of the unknown beyond Earth.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of Dune
                  Dune

                  series · 20 books · 1963

                  part of Dune Universe

                  similar byscience fictionfar futureother star systemspolitical intriguespace opera+2 more

                  Frank Herbert's Dune Chronicles opens with 1965's Dune, set on the desert planet Arrakis where House Atreides takes control of the only source of the vital spice melange and young Paul Atreides is pulled into a struggle over its politics and religion. Herbert carried the story forward across five further novels — Dune Messiah, Children of Dune, God Emperor of Dune, Heretics of Dune, and Chapterhouse: Dune — following Paul's line over the following millennia, before Brian Herbert and Kevin J. Anderson later extended the saga. Many other editions of these six novels are omnibus and box-set repackagings rather than separate stories.

                • Cover of Moties
                  Moties

                  series · 4 books · 1974

                  part of CoDominium

                  similar byscience fictionfar futureother star systemsalienspolitical intriguespace operafirst contactspace+1 more

                  Larry Niven and Jerry Pournelle's The Mote in God's Eye (1974) depicts humanity's first contact with an alien species, the Moties, set within the far-future interstellar setting of Pournelle's codominium future history. The Gripping Hand continues that first-contact crisis years later, and Outies, written by J. R. Pournelle, carries the story forward into a new generation. Together the three books trace an escalating encounter between human and Motie civilizations within the codominium universe.

                • Cover of Dune Universe
                  Dune Universe

                  universe · 78 books · 1963

                  Start hereDune · Start here

                  similar byscience fictionfar futureother star systemspolitical intriguespace opera+1 more

                  Arrakis. Dune. The desert planet, where empire runs on a single substance: the spice melange, which folds space, prolongs life, and unlocks prescience, and which exists nowhere else in the known universe. Frank Herbert's saga is a meditation dressed as an adventure — feudal houses and a secret sisterhood, engineered messiahs and the patient ecology of a world without water, all turning on the terrible gravity of who commands the spice. It reads like scripture and schemes like a war room, ten thousand years hence, among people who have outlawed the thinking machine and made instruments of themselves instead. At its heart stand Herbert's original six — Dune, Dune Messiah, Children of Dune, God Emperor of Dune, Heretics of Dune, Chapterhouse: Dune — a single deepening arc across millennia, arguing the whole way between prophecy and free will. Around that spine his son Brian Herbert and Kevin J. Anderson have raised a vast prequel architecture: Prelude to Dune, tracing the great houses a generation before Paul; Legends of Dune, reaching back to the crusade that broke the machines; the Schools of Dune cycle on the founding of Bene Gesserit, Mentat, and Navigator; the Caladan Trilogy and Heroes of Dune filling years the originals left in shadow. Many hands, dozens of volumes, one desert. What sets Dune apart is its refusal of the simple: religion is manufactured, heroes are hazards, and the sand itself — worm, water, ecology — acts as a political power. Begin where the universe did, with Frank Herbert's Dune (1965), and read the original six in order; you need nothing else to feel the full weight. The prequels are a country to explore afterward, taken by era. Beginnings are delicate times.

                • Cover of Doona
                  Doona

                  series · 3 books · 1969

                  similar byscience fictionfar futureother star systems+5 more

                  Decision at Doona begins Anne McCaffrey's series about a human colony that finds a supposedly uninhabited planet is already home to the Hrrubans, a clan-based, cat-like species — a discovery Terran policy treats as forbidden territory after an earlier first-contact attempt ended in another alien race's mass suicide. The colonists and Hrrubans must negotiate an unprecedented, closely governed coexistence rather than the separation their governments would prefer. Later books, continuing with Jody Lynn Nye, follow the two communities as that arrangement is tested by new arrivals and disputes.

                • Cover of Ender Wiggin
                  Ender Wiggin

                  series · 14 books · 1977

                  part of Ender's Game Universe

                  similar byscience fictionfar futurealiensother star systems+4 more

                  Orson Scott Card's Ender's Game (1985, expanded from his 1977 novella) follows child prodigy Andrew "Ender" Wiggin as he is recruited into a military training program built to prepare Earth's defenses for an anticipated third war against an insectoid alien species known as the Formics. The saga continues years later through Speaker for the Dead and Xenocide, following an older Ender as he confronts the moral weight of his role in that earlier conflict, and concludes the core arc in Children of the Mind, with Ender in Exile filling in the years between the first two books. Set within the wider Ender's Game universe, the series shifts from military coming-of-age story to slower, more philosophical science fiction as it progresses.

                • Cover of Hainish
                  Hainish

                  series · 33 books · 1964

                  completed

                  similar byscience fictionfar futureother star systemsreflective+2 more

                  The Hainish Cycle consists of a number of science fiction novels and stories by Ursula K. Le Guin. The cycle is set in a future history that features civilizations of human beings on planets orbiting a number of nearby stars, including Terra ("Earth"); these humans are contacting each other for the first time and establishing diplomatic relations, as well as setting up a confederacy under the guidance of the oldest of the human worlds, the peaceful planet Hain. In this history, human beings did not evolve on Earth, but they were instead the result of interstellar colonies planted by Hain in the distant past, after which interstellar travel ceased for an extended period. Some of the human races have new genetic traits, a result of ancient Hainish experiments in genetic engineering; this includes people who can dream while awake, and a world of hermaphroditic people who only enter active sexuality once per month, not knowing which sex will manifest in them. In keeping with Le Guin's narrative approach, she uses varied social and environmental settings to explore the anthropological and sociological outcomes of human evolution in those environments. The author often discounted the characterization of a so-called "Hainish Cycle".

                • Cover of Old Man's War
                  Old Man's War

                  series · 16 books · 2005

                  similar byscience fictionfar futureother star systemsspace operaspace+3 more

                  The Old Man's War series is a series of science fiction novels by John Scalzi. The first book in the series, Old Man's War, was first published in 2005 by Tor Books, and was nominated for the Hugo Award for Best Novel in 2006. In 2026 it was a finalist for the Hugo Award for Best Series.

                • Cover of Chanur
                  Chanur

                  series · 7 books · 1982

                  part of Alliance-Union Universe

                  similar byscience fictiontensefar futureother star systemsalienspolitical intriguespace operaspaceship+2 more

                  The Chanur novels are a series of five science fiction novels, forming three separate stories, written by American author C. J. Cherryh and published by DAW Books between 1982 and 1992. The first novel in the series is The Pride of Chanur (1982), which was nominated for both the Hugo and Locus Awards in 1983. The Pride of Chanur, originally a stand-alone story, was followed by the Chanur's Venture trilogy, Chanur's Venture (1984), which was shortlisted for a Locus Award in 1985; The Kif Strike Back (1985) and Chanur's Homecoming (1986). These were followed by a later sequel, Chanur's Legacy (1992). The five novels were also published in two omnibus editions: the first three in The Chanur Saga in 2000 and the next two in Chanur's Endgame in 2007.

                • Cover of Teixcalaan
                  Teixcalaan

                  series · 2 books · 2019

                  similar byscience fictiontensefar futureother star systemspolitical intriguereflectivespace opera+2 more

                  Arkady Martine's space opera duology follows Mahit Dzmare, ambassador from the small, independent Lsel Station, as she arrives in the vast Teixcalaanli Empire to investigate her predecessor's death and finds herself caught up in the empire's own succession crisis. A Memory Called Empire and A Desolation Called Peace pair court intrigue with Mahit's conflicted, outsider fascination with an empire she can't help admiring.

                • Cover of Chronicle of the Fallers
                  Chronicle of the Fallers

                  series · 2 books · 2014

                  part of Commonwealth Universe

                  similar byscience fictiontensefar futureother star systemsaliensspace opera+2 more

                  Peter F. Hamilton's Chronicle of the Fallers duology is set within his Commonwealth Saga universe, following physicist Nigel Sheldon as prophetic dreams of a lost civilization lead him into the mysterious Void and onto Bienvenido, a world settled by descendants of Commonwealth colonists under centuries-long siege by the shapeshifting, world-conquering Fallers. It comprises The Abyss Beyond Dreams and Night Without Stars.

                • HC
                  Heaven Chronicles / Zones of Thought

                  series · 8 books · 1976

                  similar byscience fictionfar futurespace operaspace+5 more

                • Cover of The Dosadi Experiment
                  The Dosadi Experiment

                  Frank Herbert · standalone novel · 1977

                  similar byscience fictiontensefar futureother star systemsalienspolitical intriguespace opera

                  From the flaps of the Berkley Putnam first edition: "In his first new work of science fiction since the best-selling Children of Dune, Frank Herbert returns to his world of Whipping Star, and involves Jorj X. McKie, Saboteur Extraordinary, in a new intrigue. In Whipping Star, McKie discovered that some of the stars in the universe are actually intelligent, super-powerful beings, and was able to befriend one of them, the star Alcyone - affectionately known as Fannie Mae. As The Dosadi Experiment opens, McKie is assigned to investigate the planet Dosadi, which is isolated from the rest of the galaxy by a "god-wall," a barrier set up by one of the intelligent stars. Dosadi is rumored to be an experimental planet, and the experimenters are the froglike Gowachin, whose culture is founded upon a strange legal system in which McKie is the only human ever trained. He learns that humans and Gowachin have been placed on Dosadi, without their consent, for an experiment that could last centuries: an experiment in extreme overcrowding. But this monstrous plot is apparently out of control, and it seems the Gowachin may be prepared to destroy Dosadi rather than expose its secret, thus breaking the peace among the races, and starting the first interstellar war. But this is just the beginning. When McKie finally reaches Dosadi he discovers that the Dosadis have taken control of their own evolution and produced a competitive, highly evolved elite, of both humans and Gowachin, who have been able to extrapolate the existence of a universe beyond the god-wall and hate whoever has imprisoned them like this. They plan to break out and avenge themselves on the galaxy."

                • Cover of Starstream
                  Starstream

                  series · 2 books · 1989

                  completed

                  similar byscience fictiontensefar futureother star systemsspace operaspace+1 more

                  Starstream groups Jeffrey A. Carver's two linked science-fiction novels, From a Changeling Star (1989) and its direct sequel Down the Stream of Stars (1990). The two were published within a year of each other under the same author.

                • Cover of Cycle of Fire
                  Cycle of Fire

                  Hal Clement · standalone novel · 1957

                  similar byscience fictiontensefar futureother star systemsfriendshipaliensreflective+1 more

                  After his ship crashed on the inhospitable planet Abyorman, Nils Kruger had spent weeks wandering across the face of the planet.suffering from blistering heat, the searing cold of an alien climate. Now he had found a fellow wanderer, Dar, an alien castaway. They may both die. The human opts to do something about it. Dar, who knows the time of his death in advance, opts to do nothing. Which of them is right? Perhaps both

                • Cover of Culture
                  Culture

                  series · 15 books · 1987

                  completed

                  part of The Culture

                  similar byscience fictionfar futurespace opera+4 more

                  The Culture series is a science fiction series written by Scottish author Iain M. Banks and released from 1987 until 2012. The stories centre on The Culture, a utopian, post-scarcity space society of humanoid aliens and advanced superintelligent artificial intelligences living in artificial habitats spread across the Milky Way galaxy. The main themes of the series are the dilemmas that an idealistic, more-advanced civilization faces in dealing with smaller, less-advanced civilizations that do not share its ideals, and whose behaviour it sometimes finds barbaric. In some of the stories, action takes place mainly in non-Culture environments, and the leading characters are often on the fringes of the Culture, sometimes acting as agents of the Culture in its plans to civilize the galaxy. Each novel is a self-contained story with new characters, although reference is occasionally made to the events of previous novels.

                • Cover of Honorverse
                  Honorverse

                  universe · 83 books · 1993

                  Start hereHonor Harrington · Start here

                  similar byscience fictionfar futureother star systemsspace operaspace+2 more

                  The wedge comes up, the sidewalls burn to life, and two walls of battle close across light-minutes of empty vacuum trading missile broadsides — because in the Honorverse, war is still fought by the doctrine of the age of sail, only the ocean is the interstellar void and the ships-of-the-line are dreadnoughts. This is David Weber's future, two millennia on: a galaxy of star nations bound by treaty, trade, and old grudges, where the small, wealthy Star Kingdom of Manticore holds a wormhole junction the commerce of humanity runs through, and the expansionist People's Republic of Haven means to take it. At the center stands one officer, Honor Harrington — captain, then something far larger — and the six-limbed empathic treecat who rides her shoulder. The spine is the Honor Harrington novels, more than a dozen books that carry her from an overlooked frontier picket up through fleet command and the knife-politics of a monarchy at war. Around that spine branch parallel lines, several written with collaborators: the Saganami Island books follow a younger generation of officers in the contested Talbott Cluster; the Wages of Sin novels, with Eric Flint, chase the genetic-slave trade to its source on Mesa; Manticore Ascendant, with Timothy Zahn, reaches back centuries to the Navy's shaky founding; and the Star Kingdom books, with Jane Lindskold, tell how humans and treecats first met. Anthologies fill the seams. Weber writes competence and consequence — dense hardware, denser politics, victories that cost, and a heroine whose defining virtue is her refusal to spend lives cheaply or duck the ones she must. Begin with On Basilisk Station: one ship, one thankless posting, one impossible situation. Read the main line in publication order; the collaborating branches reward you later, once the map of Manticore is yours.

                • T
                  Thistledown

                  series · 5 books · 1978

                  completed

                  similar byscience fictionfar futurespace+5 more

                • Cover of Alliance-Union Universe
                  Alliance-Union Universe

                  universe · 173 books · 1976

                  Start hereCompany Wars · The central sequence

                  similar byscience fictionfar future+7 more

                  The dark between the stars belongs to no one, and everyone who lives out here knows it: the merchanter Families hauling cargo between stations that cannot feed themselves, the Earth Company clutching at colonies it can no longer supply, the Union breeding its cloned azi to settle worlds faster than birth allows. C. J. Cherryh's Alliance-Union is a future history of humankind's spread across the third and fourth millennia, told from inside the pressure — no clean empires, only stations, ships, treaties, and the people caught in the machinery of who holds the jump-points. The sequence runs from the first laborious pre-FTL stations through the Company Wars, the independence struggle that breaks over Pell in Downbelow Station (Hugo, 1981), to the genetics and cold politics of Union's homeworld in Cyteen (Hugo, 1988) and its sequel Regenesis. Around that spine cluster the merchanter novels of trader Families, the Faded Sun trilogy of human envoys among the martial alien Mri, and the Chanur books, narrated from the hierarchical, whiskered viewpoint of the hani. On the isolated world of Merovin, the Merovingen Nights anthologies open the setting to other hands — Mercedes Lackey, Janet and Chris Morris, Nancy Asire — a shared world braided into the whole. What sets it apart is intimacy at scale. Cherryh drops you without a map into a single skull and lets you assemble the politics from what that person fears and bargains for; the aliens are genuinely alien, loyalty is always provisional, and the real antagonist is usually logistics. Most books stand alone, in her words, "like real history." The surest way in is Downbelow Station — the war seen from one besieged station — then Cyteen, for the mind that shaped the other side.

                • Cover of Janissaries
                  Janissaries

                  series · 4 books · 1979

                  similar byscience fictiontensefar futureother star systemspolitical intrigue+3 more

                  Janissaries are an American series of military and political-based science fiction novels are set in an interstellar confederation of races, in which humans are a slave race entrusted with military affairs and law enforcement. They were written by Jerry Pournelle, with Roland J. Green co-authoring the second two books.

                • Cover of Imperial Radch
                  Imperial Radch

                  series · 7 books · 2012

                  part of Radchaai Universe

                  similar byscience fictionfar futureother star systemsspace operaspace+4 more

                  Ann Leckie's Imperial Radch trilogy (Ancillary Justice, Ancillary Sword, Ancillary Mercy, 2013-2015) follows Breq, the sole surviving fragment of an AI that once inhabited both a troop-transport starship and dozens of soldier bodies, now alone and hunting for revenge inside the vast, expansionist Radch empire. Breq's quest widens across the trilogy into a conflict with the empire's own fractured ruler, and the books use her alien difficulty perceiving gender to unsettle the space-opera conventions around her.

                • Cover of Uplift
                  Uplift

                  series · 5 books · 1980

                  part of Uplift Universe

                  similar byscience fictionfar futurealiensother star systemsspace operaspace+1 more

                  David Brin's Uplift trilogy opens with Sundiver, sending human explorers into the Sun itself, then follows a dolphin-crewed starship on the run from hostile aliens in Startide Rising and a fight over the colony world Garth in The Uplift War. The books sit inside Brin's wider Uplift Universe, built on the idea that spacefaring "patron" species genetically engineer younger "client" species into full sapience, with humanity an anomaly that reached the stars without a patron of its own.

                • Cover of Ringworld
                  Ringworld

                  series · 5 books · 1970

                  part of Known Space

                  similar byscience fictionfar futureother star systemsaliensspace operaspace

                  The Ringworld series is a series of science fiction novels written by American author Larry Niven. It is part of his Known Space series of stories. Its backdrop is the Ringworld, a giant artifact 3 million times the surface area of Earth circling a star. The series is composed of four standalone science fiction novels, the original award-winning book and its three sequels:1970: Ringworld 1979: The Ringworld Engineers 1996: The Ringworld Throne 2004: Ringworld's Children

                • Cover of Thousand Cultures
                  Thousand Cultures

                  series · 6 books · 1991

                  similar byscience fictionfar futureother star systemsspace operaspace+2 more

                • Cover of Starbridge
                  Starbridge

                  series · 9 books · 1989

                  similar byscience fictionfar futureother star systemsaliensfirst contact+2 more