Loreful
HomeDiscover
Search series, authors…⌘K
Loreful

Reading orders for SF/F series and shared universes — with your place kept in every one.

Explore

UniversesSeriesWorksAuthorsAtlas

Help

FAQAboutSite map

Account & legal

Sign inCreate accountPrivacyTerms

Data

Built on ISFDB, Wikipedia, Wikidata and Open Library. Curated reading orders carry their reasoning on the page; the rest follow publication order. Data sources & licenses

© Loreful · data: ISFDB · CC BY

More like Witch Switch

anchored on:fantasywitchesmiddle gradeurban fantasyfriendshipbig city+2 more

but

Mood

The mood the book leaves you in.

  • The reading experience is propelled by journeys, exploration, and physical risk; excitement and forward momentum dominate over dread or introspection.
  • Joy and loss are deliberately mixed; the resolution grants characters something real while taking something else away, leaving warmth and sorrow together.
  • The book demands work from the reader — dense prose, difficult structure, unfamiliar ideas, or morally uncomfortable material — as part of its intended effect.
  • Grim events, cruelty, or despair dominate the atmosphere, and the book does not soften them with comfort or comic relief.
  • The atmosphere is quietly unsettling — wrongness, unease, and the uncanny pervade the book without necessarily escalating into overt horror.
  • The book is built to move the reader; character feeling is foregrounded and major scenes aim at a strong emotional response.
  • Humor is a primary aim and the prose plays for laughs — comic situations, wit, or dialogue produce sustained comedy, not occasional levity.
  • The book insists that things can improve; effort and decency are shown to matter, and the arc bends toward better outcomes even through hardship.
  • The book teaches as it goes — real facts, history, science, or craft are conveyed in enough depth that learning is part of the reading experience.
  • The book is designed to uplift and motivate, presenting perseverance or achievement in a way that invites the reader to aspire or act.
  • The overall register is cheerful and easygoing; stakes are kept gentle and the book avoids dwelling on pain or dread.
  • Withheld information drives the experience; the book sustains enigmas and secrets the reader wants resolved, whatever its genre.
  • The book is contemplative and inward-looking, giving more weight to thought, memory, and meaning than to external events.
  • The book works as comfort reading — low tension, a soothing pace, and an atmosphere the reader can unwind in.
  • Grief, loss, or melancholy set the dominant register, and the book lets sorrow stand rather than resolving it into comfort.
  • Sustained suspense is the point; the book keeps the reader braced for what happens next through danger, pressure, or impending revelation.
  • Playful invention and charm define the register — fanciful conceits, light absurdity, and a narration that delights in its own oddity.

About

What the story runs on.

  • Stories centered on witches and the practice of witchcraft — covens, hedge magic, familiars, and the witch's place in her community.
  • Stories in which demons or devils — infernal beings, their bargains, possessions, and hierarchies — drive the plot.
  • Stories structured as a quest — a journey undertaken to find, deliver, or destroy something of great import.
  • Stories in which staying alive against nature, catastrophe, or scarcity is the central problem.
  • Stories of lovers kept apart by law, family, faith, or station, where the obstacle to love is the plot.
  • Stories in which a friendship — its making, testing, or loss — is the emotional center.
  • Stories of growing up — a young protagonist crossing from childhood into adult knowledge and responsibility.
  • Stories about who a character truly is — self-discovery, doubled lives, and the search for a self.
  • Stories in which a buried family truth — hidden parentage, crimes, or shames — surfaces and reorders the present.
  • Stories driven by maneuvering for power — factions, conspiracies, and statecraft conducted in shadow.
  • Stories in which war itself is the subject — combat, occupation, and what warfare does to soldiers and civilians.
  • Stories organized around investigating a killing — the case, the clues, and the pursuit of the killer, in any genre's clothing.

Shelf

Where it sits in the library.

    • Fiction built on magic or other supernatural elements that have no scientific explanation.
    • Secondary-world fantasy at large scale, where the fate of nations or the world turns on the protagonists' struggle.
    • Fantasy set in a recognizably modern city or contemporary world where the supernatural intrudes on everyday life.
    • Fantasy that blends in horror's atmosphere and imagery, keeping a fantastical frame around grim or frightening material.
    • Action-driven fantasy following warriors or rogues with personal stakes against sorcerous threats, rather than world-spanning conflicts.
    • Fantasy set in a real historical period or a close analogue of one, with magic woven into the era.
    • Fantasy in which protagonists cross from the ordinary world into another world through a portal or similar passage.
    • Fiction that retells or reworks a traditional fairy tale in a new form or setting.
    • Fantasy drawing directly on myths, legends, and folklore, retelling them or building on their figures and logic.
    • Fantasy of ghosts, vampires, shapeshifters, psychics, and similar phenomena, usually set in an otherwise ordinary world.
    • Fiction mixing science-fictional trappings with overtly magical or impossible elements in one setting.
    • Low-stakes fantasy emphasizing comfort, community, and everyday pleasures over conflict and peril.
    • Speculative fiction of pervasive moral ambiguity, violence, and cynicism that rejects heroic conventions — fantasy and SF alike.
      • Fiction that extrapolates from science and technology — future societies, space travel, or speculative inventions — within at least nominally natural laws.
      • Science fiction of interstellar scope — starships, galactic polities, and adventure across star systems.
      • Science fiction committed to scientific rigor, where technical plausibility constrains the story.
      • Science fiction centered on armed forces and warfare, told largely from a military point of view.
      • Science fiction of networked, corporate-dominated near futures, pairing high technology with social decay.
      • Science fiction styled on nineteenth-century steam-powered technology, often in a Victorian or pseudo-Victorian setting.
      • Fiction depicting an oppressive or catastrophic society, presented as a warning.
      • Fiction set after civilization's collapse, following survivors in the ruins of the old world.
      • Fiction in which characters move between past and future, and the mechanics or consequences of that travel drive the plot.
      • Fiction exploring a world where a historical event went differently and history diverged from ours.
      • Science fiction about humanity's first encounter and communication with an alien intelligence.
      • Science fiction in which extraterrestrial forces attack or occupy Earth and humanity resists.
      • Fiction whose primary aim is to frighten or unsettle the reader through dread, menace, or the monstrous.
      • Horror of vast, indifferent, incomprehensible entities before which humanity is insignificant, in the Lovecraft tradition.
      • Horror of decaying houses, buried family secrets, and oppressive atmosphere in the Gothic literary tradition.
      • Horror centered on hauntings and the returning dead.
      • Horror located in the mind — paranoia, obsession, and unreliable perception rather than external monsters.
      • Horror built around the reanimated dead and survival amid their outbreaks.
      • Horror defined by explicit, transgressive gore that refuses to cut away from violence.
      • Speculative fiction of the strange and uncanny that resists both natural explanation and standard genre categories.
      • Fiction organized around solving a crime or puzzle, typically following an investigator toward the identification of a culprit.
      • A puzzle-first mystery that lays out clues so the culprit's identity can be deduced before the reveal.
      • Crime fiction of moral ambiguity, fatalism, and hard-edged style, set among the corrupt and the doomed.
      • A mystery following the realistic routines of police work — forensics, interviews, and case-building.
      • A gentle mystery with an amateur sleuth, a small community, and violence kept off the page.
      • A mystery set in a past era, where the investigation works within that period's methods and society.
      • Fast-paced fiction driven by imminent danger, pursuit, or high-stakes conspiracy, built to sustain tension.
      • A thriller of espionage — agents, tradecraft, and intelligence services in conflict.
      • A thriller centered on lawyers and the courtroom, where litigation carries the suspense.
      • A thriller driven by detailed contemporary or near-future technology, often military or scientific.
      • A thriller whose tension comes from mental states and manipulation between characters rather than external action.
      • Fiction whose central plot is a romantic relationship and its development toward an emotionally satisfying resolution.
      • Romance in which one or both partners are supernatural beings, blending fantasy elements into the love story.
      • A fantasy-romance hybrid in which the romantic arc and the fantasy plot carry equal weight.
      • Romance set in a past era, with courtship shaped by the period's society and manners.
      • Romance set in the present day, without supernatural or historical elements.
      • Fiction set in a real past period, where the historical setting materially shapes characters and events.
        • General and literary fiction emphasizing prose style, character interiority, or formal ambition over genre plot conventions.
        • Fiction in a realistic world where magical events occur and are treated as ordinary, in the tradition of Latin American literature.
        • Fiction that ridicules people, institutions, or society in order to criticize them.
        • Fiction of dreamlike, irrational imagery and logic that breaks from realistic representation.
        • Fiction that plays with narrative convention through metafiction, fragmentation, and self-reference.
        • Fiction propelled by journeys, exploration, and physical peril, where action and survival carry the plot.
        • Adventure fiction of ships and seafaring — naval engagements, voyages, and life at sea.
        • Fiction of the American frontier West — gunmen, ranchers, and lawmen, typically in the late nineteenth century.
        • Fiction centered on soldiers, campaigns, and the experience of warfare, historical or imagined.
          • Fiction written primarily to amuse, using comedic situations, wit, or parody as its organizing principle.
            • Multi-generational fiction following a family or dynasty across decades, with inheritance and kinship as the through-line.
              • Fiction whose world runs on explicit game mechanics — levels, stats, and skills that characters can see and exploit.
                • Fiction about costumed or superpowered heroes and their conflicts with comparable villains.

                Practical

                How long a commitment, whether it stands alone, and whether it has finished.

                Tap a chip to ask for it · tap again to rule it out · once more to clear. Numbers show what would be left.

                • Cover of Castle Hangnail
                  Castle Hangnail

                  Ursula Vernon · standalone novel · 2015

                  similar bywitchesfantasylightheartedwhimsicalmiddle grade

                  When little twelve-year-old Molly arrives at Castle Hangnail to fill the vacancy for a wicked witch, the minions who dwell there have no choice but to give her the job, and at first it seems she'll be able to keep the castle open, but Molly has quite a few secrets that could cause trouble.

                • Cover of The Wind in the Willows Universe
                  The Wind in the Willows Universe

                  series · 17 books · 1908

                  similar byfantasyfriendship+2 more

                • Cover of Witch Wars
                  Witch Wars

                  series · 6 books · 2015

                  similar byfantasywitchesmiddle grade+4 more

                • Cover of The Hobbit
                  The Hobbit

                  series · 2 books · 1937

                  completed

                  part of Tolkien's legendarium

                  similar byfantasywhimsicalmiddle grade

                  The Hobbit (1937) is J. R. R. Tolkien's children's fantasy novel following the reluctant burglar Bilbo Baggins, who joins a company of dwarves and the wizard Gandalf on a journey to reclaim treasure guarded by the dragon Smaug. It stands as a complete adventure on its own, but shares its setting with the rest of Tolkien's legendarium and leads into the events of The Lord of the Rings.

                • Cover of The Fairy Chronicles
                  The Fairy Chronicles

                  series · 65 books · 2004

                  similar byfantasywhimsicallightheartedfriendshipfae+1 more

                • Cover of Stardust
                  Stardust

                  Neil Gaiman · standalone novel · 1998

                  similar byfantasywhimsicalfae+1 more

                  Stardust is a 1999 fantasy novel by British writer Neil Gaiman, usually published with illustrations by Charles Vess. Stardust has a different tone and style from most of Gaiman's prose fiction, being consciously written in the tradition of pre-Tolkien English fantasy, following in the footsteps of authors such as Lord Dunsany and Hope Mirrlees. It is concerned with the adventures of a young man from the village of Wall, which borders the magical land of Faerie.

                • Cover of Nevermoor / Morrigan Crow
                  Nevermoor / Morrigan Crow

                  series · 4 books · 2017

                  similar byfantasybig citywhimsicalmiddle grade

                  The Nevermoor Series is a fantasy children's book series written by Australian author Jessica Townsend. The series centres around Morrigan Crow, a cursed child living in the Wintersea Republic fated to die on the last day of the year, Eventide. When it comes time for her to die on Eventide day, she is saved by Jupiter North and taken to the city of Nevermoor, where Jupiter is a hotel owner and member of the Wundrous Society, a prestigious institution where each member has a "knack", a supernatural ability that allows them to be better than average.

                • Cover of At the Back of the North Wind
                  At the Back of the North Wind

                  series · 2 books · 1869

                  similar byfantasywhimsicalfriendship

                • Cover of Three Good Deeds
                  Three Good Deeds

                  Vivian Vande Velde · standalone novel · 2005

                  similar byfantasywhimsicalwitchesmiddle grade+1 more

                  Caught stealing some goose eggs from a witch, Howard is cursed for his heartlessness and turned into a goose himself, and he can only become human again by performing three good deeds.

                • Cover of Dot and Tot of Merryland
                  Dot and Tot of Merryland

                  L. Frank Baum · standalone novel · 1901

                  similar byfantasylightheartedwhimsicalfriendship

                  Dot and Tot of Merryland is a 1901 novel by L. Frank Baum. After Baum wrote The Wonderful Wizard of Oz, he wrote this story about the adventures of a little girl named Dot and a little boy named Tot in a land reached by floating on a river that flowed through a tunnel. The land was called Merryland and was split into seven valleys. The book was illustrated by artist W. W. Denslow. He had illustrated three previous Baum books that were advertised in Dot and Tot, Father Goose: His Book, The Songs of Father Goose, as well as The Wonderful Wizard of Oz.

                • Cover of Tucker & Harry
                  Tucker & Harry

                  series · 8 books · 1960

                  completed

                  similar bybig citylightheartedfantasywhimsicalfriendship

                • Cover of Enchanted Forest
                  Enchanted Forest

                  series · 7 books · 1985

                  similar byfantasylightheartedmiddle grade+1 more

                  Patricia Collins Wrede is an American author of fantasy literature. She is known for her Enchanted Forest Chronicles series for young adults, which was voted number 84 in NPR's 100 Best-Ever Teen Novels list.

                • Cover of Boggart
                  Boggart

                  series · 3 books · 1993

                  similar byfantasylightheartedwhimsicalfae+2 more

                  Susan Cooper's Boggart series begins with the 1993 novel The Boggart, nominated for a Young Reader's Choice Award, and continues across three further books including The Boggart and the Monster and A Box of Boggarts. Cooper, best known for The Dark Is Rising sequence, writes here in a lighter fantasy-adventure register.

                • Cover of The Girl Who Drank the Moon
                  The Girl Who Drank the Moon

                  Kelly Barnhill · standalone novel · 2016

                  similar byfantasywitchesmiddle grade+2 more

                  From the Copyright page: An epic fantasy about a young girl raised by a witch, a swamp monster, and a Perfectly Tiny Dragon, who must unlock the powerful magic buried deep inside her.

                • Cover of Fairy Blossoms
                  Fairy Blossoms

                  series · 6 books · 2008

                  similar byfantasylightheartedwhimsicalfriendshipfae

                • Cover of Candy Fairies
                  Candy Fairies

                  series · 23 books · 2010

                  similar byfantasylighthearted+3 more

                • Cover of The Wide-Awake Princess
                  The Wide-Awake Princess

                  series · 7 books · 2010

                  similar byfantasylightheartedmiddle grade+1 more

                • Cover of The Princess Imposter
                  The Princess Imposter

                  Vivian Vande Velde · standalone novel · 2017

                  similar byfantasylightheartedwhimsicalmiddle gradefae

                  Princess Gabriella is accustomed to a certain kind of castle life. So when she wakes up one morning in a crowded hut, surrounded by squabbling fairy siblings, it takes all her princess training to maintain her poise and good manners.

                • Cover of The Whispering Knights
                  The Whispering Knights

                  Penelope Lively · standalone novel · 1971

                  similar byfantasywhimsicalwitchesurban fantasymiddle grade+1 more

                  "Three children concoct a witch's brew that conjures up Morgan Le Fay in the guise of a local tycoon's wife who immediately stirs up trouble in the village." --summary, library records of the 1st US ed. "King Arthur's sister Morgan shows up as a local rich man's new wife, influencing him to steer a superhighway through the village" --Kirkus Reviews (contemporary, undated online, negative, see above) "it takes Morgan a little time to catch up with history ... [But she] seizes upon a uniquely modern method of destroying not only the village but the entire fruitful valley--she will cause the politicians to bury it under six lanes of concrete." The "Whispering Knights" of the title are the local "circle of ancient ceremonial stones", which have supernatural powers of their own. --broadly positive review by {{a|Katherine Paterson}}, The Washington Post 1976-05-02 pL2 "World of Wonders", 3 new fantasies for ages 8 to 12

                • Cover of Furthermore Universe
                  Furthermore Universe

                  series · 2 books · 2016

                  similar byfantasywhimsicalfriendshipmiddle grade

                • Cover of Philippa Fisher
                  Philippa Fisher

                  series · 3 books · 2008

                  similar byfantasywhimsicallightheartedfriendshipfae+1 more

                • Cover of Trot and Cap'n Bill
                  Trot and Cap'n Bill

                  series · 4 books · 1911

                  similar byfantasywhimsical+1 more

                  L. Frank Baum's Trot and Cap'n Bill duology (The Sea Fairies, 1911; Sky Island, 1912) follows Californian girl Trot and her one-legged sailor companion Cap'n Bill through undersea fairy kingdoms and then to a fantastical island divided between light and dark peoples. Baum conceived it as a rival series to his own Oz books, but both characters were eventually folded into Oz continuity and reappear as regulars in later Oz novels.

                • Cover of Matter-of-Fact Magic
                  Matter-of-Fact Magic

                  series · 10 books · 1969

                  completed

                  similar byfantasywitcheslightheartedwhimsical+1 more

                • Cover of Magic in Manhattan (Sarah Mlynowski)
                  Magic in Manhattan (Sarah Mlynowski)

                  series · 4 books · 2005

                  similar bywitcheslightheartedurban fantasy+3 more