Series
Books like Uncle: 9 series to read next
Uncle is fantasy and humor, set in secondary world, whimsical and funny in register. The 9 series below are ranked by how much of that they share — each card says which parts.
Uncle is 6 books, 1964–1973.
- Narnia
- Myth Adventures
- Tolkien's legendarium
- Redwall
- At the Back of the North Wind
- Tortall
- Gentleman Bastard Sequence
- Eddie Bear
- Discworld
- Myth AdventuresSeries
seriesRobert Asprin, Jody Lynn Nye & Phil Foglio33 books1978
Fantasy and humor, funny in tone, set in secondary world.
matchedfantasysecondary worldfunnyhumor
- Tolkien's legendariumUniverse
universe163 books1923
Fantasy, set in secondary world.
matchedsecondary worldfantasy
seriesGeorge MacDonald & Elizabeth Lewis2 books1869
About coming of age.
matchedfriendshipwhimsicalfantasy
- TortallUniverse
universe25 books1983
Adventurous in tone, about coming of age.
matchedsecondary worldfantasyyoung adult
seriesScott Lynch7 books2006
About con artists and heist, set in big city.
matchedsecondary worldfantasy
- Eddie BearSeries
seriesRobert Rankin2 books2002
Fantasy and humor, funny and whimsical in tone.
matchedfantasyfunnywhimsicalhumor
- DiscworldUniverse
universe84 books1983
Fantasy, funny in tone, set in secondary world.
matchedsecondary worldfantasyfunny
Read next in Uncle
Why these
No sales rank, no star ratings, no readers also bought.
Shared terms are not a promise that a book feels the same. Two series can be far-future political intrigue and read nothing alike — what the ranking can say is what they are about, and each card says which parts it shares.
Questions readers ask
- What should I read after Uncle?
- Narnia — the closest match to Uncle on what it is about, not on what sells.
- Where do I start with Uncle?
- Uncle. It is the entry the catalogue recommends for Uncle.
- How big is Uncle?
- Uncle is 6 books, 1964–1973.
- Is Uncle finished?
- Yes — 6 books, 1964–1973.














